Recombinant Human NUDT1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NUDT1-1385H
Product Overview : NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_002443) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A rare single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described.
Molecular Mass : 18 kDa
AA Sequence : MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NUDT1 nudix hydrolase 1 [ Homo sapiens (human) ]
Official Symbol NUDT1
Synonyms NUDT1; nudix (nucleoside diphosphate linked moiety X)-type motif 1; MTH1; 7,8-dihydro-8-oxoguanine triphosphatase; 7; 8 dihydro 8 oxoguanine triphosphatase; 8 oxo 7; 8 dihydrodeoxyguanosine triphosphatase; 8 dihydroguanosine triphosphatase; 8 oxo dGTPase; mutT human homolog 1; nucleoside diphosphate linked moiety X type motif 1; nudix motif 1; 8-oxo-dGTPase; 2-hydroxy-dATP diphosphatase; 8-oxo-7,8-dihydroguanosine triphosphatase; 8-oxo-7,8-dihydrodeoxyguanosine triphosphatase; nucleoside diphosphate-linked moiety X motif 1; nucleoside diphosphate-linked moiety X-type motif 1;
Gene ID 4521
mRNA Refseq NM_002452
Protein Refseq NP_002443
MIM 600312
UniProt ID P36639

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUDT1 Products

Required fields are marked with *

My Review for All NUDT1 Products

Required fields are marked with *

0
cart-icon