Recombinant Human NUDT1, His-tagged

Cat.No. : NUDT1-30252TH
Product Overview : Recombinant full length Human MTH1 with an N terminal His tag; 176 amino acids with tag, MWt 20.1 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 156 amino acids
Description : Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described.
Conjugation : HIS
Molecular Weight : 20.100kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Gene Name NUDT1 nudix (nucleoside diphosphate linked moiety X)-type motif 1 [ Homo sapiens ]
Official Symbol NUDT1
Synonyms NUDT1; nudix (nucleoside diphosphate linked moiety X)-type motif 1; MTH1; 7,8-dihydro-8-oxoguanine triphosphatase; 7; 8 dihydro 8 oxoguanine triphosphatase; 8 oxo 7; 8 dihydrodeoxyguanosine triphosphatase; 8 dihydroguanosine triphosphatase; 8 oxo dGTPase;
Gene ID 4521
mRNA Refseq NM_002452
Protein Refseq NP_002443
MIM 600312
Uniprot ID P36639
Chromosome Location 7p22
Function 8-oxo-7,8-dihydrodeoxyguanosine triphosphate pyrophosphatase activity; 8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity; GTPase activity; hydrolase activity; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUDT1 Products

Required fields are marked with *

My Review for All NUDT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon