Recombinant Human NUDT16 protein, T7/His-tagged

Cat.No. : NUDT16-237H
Product Overview : Recombinant human NUDT16 (194aa, Isoform-II, derived from BC031215) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 194 a.a.
Form : 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFAGARRLELGEALALGSGWRHVCHALLYAPDPGMLFGRIPLRYAILM QMRFDGRLGFPGGFVDTQDRSLEDGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLA VEAGATRAKDHGLEVLGLVRVPLYTLRDGVGGLPTFLENSFIGSAREQLLEALQDLGLLQSGSISGLKIPAHH
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name NUDT16 nudix (nucleoside diphosphate linked moiety X)-type motif 16 [ Homo sapiens ]
Official Symbol NUDT16
Synonyms NUDT16; nudix (nucleoside diphosphate linked moiety X)-type motif 16; U8 snoRNA-decapping enzyme; FLJ31265; nudix motif 16; U8 snoRNA-binding protein H29K; nucleoside diphosphate-linked moiety X motif 16; FLJ34034; FLJ36248;
Gene ID 131870
mRNA Refseq NM_001171905
Protein Refseq NP_001165376
MIM
UniProt ID Q96DE0
Chromosome Location 3q21.3
Function RNA binding; hydrolase activity; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All METAP1 Products

Required fields are marked with *

My Review for All METAP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon