Recombinant Human NUDT16 protein, T7/His-tagged
Cat.No. : | NUDT16-237H |
Product Overview : | Recombinant human NUDT16 (194aa, Isoform-II, derived from BC031215) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 194 a.a. |
Form : | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFAGARRLELGEALALGSGWRHVCHALLYAPDPGMLFGRIPLRYAILM QMRFDGRLGFPGGFVDTQDRSLEDGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLA VEAGATRAKDHGLEVLGLVRVPLYTLRDGVGGLPTFLENSFIGSAREQLLEALQDLGLLQSGSISGLKIPAHH |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | NUDT16 nudix (nucleoside diphosphate linked moiety X)-type motif 16 [ Homo sapiens ] |
Official Symbol | NUDT16 |
Synonyms | NUDT16; nudix (nucleoside diphosphate linked moiety X)-type motif 16; U8 snoRNA-decapping enzyme; FLJ31265; nudix motif 16; U8 snoRNA-binding protein H29K; nucleoside diphosphate-linked moiety X motif 16; FLJ34034; FLJ36248; |
Gene ID | 131870 |
mRNA Refseq | NM_001171905 |
Protein Refseq | NP_001165376 |
MIM | |
UniProt ID | Q96DE0 |
Chromosome Location | 3q21.3 |
Function | RNA binding; hydrolase activity; metal ion binding; |
◆ Recombinant Proteins | ||
METAP1-2823C | Recombinant Chicken METAP1 | +Inquiry |
METAP1-4134H | Recombinant Human METAP1 Protein (Met1-Phe386) | +Inquiry |
METAP1-2735R | Recombinant Rhesus monkey METAP1 Protein, His-tagged | +Inquiry |
NUDT16-954H | Recombinant Human NUDT16, His-tagged | +Inquiry |
NUDT16-2326H | Recombinant Human NUDT16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT16-447HCL | Recombinant Human NUDT16 lysate | +Inquiry |
METAP1-2887HCL | Recombinant Human METAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METAP1 Products
Required fields are marked with *
My Review for All METAP1 Products
Required fields are marked with *