Recombinant Human NUDT7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NUDT7-1326H
• Product Overview: NUDT7 MS Standard C13 and N15-labeled recombinant protein (NP_001099133) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene.
• Molecular Mass: 26.8 kDa
• AA Sequence: MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPTFEVQFNLNDVLASSEELFLKVHKKATSRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NUDT7 nudix hydrolase 7 [ Homo sapiens (human) ]
• Official Symbol: NUDT7
• Synonyms: NUDT7; nudix (nucleoside diphosphate linked moiety X)-type motif 7
• Gene ID: 283927
• mRNA Refseq: NM_001105663
• Protein Refseq: NP_001099133
• MIM: 609231
• UniProt ID: P0C024