Recombinant Human NUDT7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NUDT7-1326H |
Product Overview : | NUDT7 MS Standard C13 and N15-labeled recombinant protein (NP_001099133) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. |
Molecular Mass : | 26.8 kDa |
AA Sequence : | MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPTFEVQFNLNDVLASSEELFLKVHKKATSRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NUDT7 nudix hydrolase 7 [ Homo sapiens (human) ] |
Official Symbol | NUDT7 |
Synonyms | NUDT7; nudix (nucleoside diphosphate linked moiety X)-type motif 7; |
Gene ID | 283927 |
mRNA Refseq | NM_001105663 |
Protein Refseq | NP_001099133 |
MIM | 609231 |
UniProt ID | P0C024 |
◆ Recombinant Proteins | ||
Nudt7-4545M | Recombinant Mouse Nudt7 Protein, Myc/DDK-tagged | +Inquiry |
NUDT7-4538C | Recombinant Chicken NUDT7 | +Inquiry |
NUDT7-2949R | Recombinant Rhesus Macaque NUDT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUDT7-925H | Recombinant Human NUDT7 | +Inquiry |
NUDT7-3131R | Recombinant Rhesus monkey NUDT7 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUDT7 Products
Required fields are marked with *
My Review for All NUDT7 Products
Required fields are marked with *