Recombinant Human NUDT7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NUDT7-1326H
Product Overview : NUDT7 MS Standard C13 and N15-labeled recombinant protein (NP_001099133) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene.
Molecular Mass : 26.8 kDa
AA Sequence : MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPTFEVQFNLNDVLASSEELFLKVHKKATSRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NUDT7 nudix hydrolase 7 [ Homo sapiens (human) ]
Official Symbol NUDT7
Synonyms NUDT7; nudix (nucleoside diphosphate linked moiety X)-type motif 7;
Gene ID 283927
mRNA Refseq NM_001105663
Protein Refseq NP_001099133
MIM 609231
UniProt ID P0C024

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUDT7 Products

Required fields are marked with *

My Review for All NUDT7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon