Recombinant Human NUP43 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NUP43-1919H |
Product Overview : | NUP43 MS Standard C13 and N15-labeled recombinant protein (NP_942590) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160. |
Molecular Mass : | 42.2 kDa |
AA Sequence : | MEEIYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEENYISLWSIGDFGNLDSDGGFEGDHQLLCDIRHHGDVMDLQFFDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCNNPEIVTVGEDGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAHEAEMWEVHFHPSNPEHLFTCSEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAIYVTRHLFSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NUP43 nucleoporin 43kDa [ Homo sapiens (human) ] |
Official Symbol | NUP43 |
Synonyms | NUP43; nucleoporin 43kDa; bA350J20.1; FLJ13287; Nup43; |
Gene ID | 348995 |
mRNA Refseq | NM_198887 |
Protein Refseq | NP_942590 |
MIM | 608141 |
UniProt ID | Q8NFH3 |
◆ Recombinant Proteins | ||
NUP43-10997M | Recombinant Mouse NUP43 Protein | +Inquiry |
NUP43-1417H | Recombinant Human NUP43, His-tagged | +Inquiry |
NUP43-6274M | Recombinant Mouse NUP43 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUP43-12149Z | Recombinant Zebrafish NUP43 | +Inquiry |
NUP43-1919H | Recombinant Human NUP43 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUP43-3630HCL | Recombinant Human NUP43 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUP43 Products
Required fields are marked with *
My Review for All NUP43 Products
Required fields are marked with *