Recombinant Human NUTF2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NUTF2-3863H
• Product Overview: NUTF2 MS Standard C13 and N15-labeled recombinant protein (NP_005787) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a cytosolic factor that facilitates protein transport into the nucleus. The encoded protein is required for nuclear import of the small Ras-like GTPase, Ran which is involved in numerous cellular processes. This protein also interacts with the nuclear pore complex glycoprotein p62.
• Molecular Mass: 14.5 kDa
• AA Sequence: MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFGSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NUTF2 nuclear transport factor 2 [ Homo sapiens (human) ]
• Official Symbol: NUTF2
• Synonyms: NUTF2; nuclear transport factor 2; NTF2; PP15; NTF-2; placental protein 15
• Gene ID: 10204
• mRNA Refseq: NM_005796
• Protein Refseq: NP_005787
• MIM: 605813
• UniProt ID: P61970