Recombinant Human NUTF2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NUTF2-3863H |
Product Overview : | NUTF2 MS Standard C13 and N15-labeled recombinant protein (NP_005787) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a cytosolic factor that facilitates protein transport into the nucleus. The encoded protein is required for nuclear import of the small Ras-like GTPase, Ran which is involved in numerous cellular processes. This protein also interacts with the nuclear pore complex glycoprotein p62. |
Molecular Mass : | 14.5 kDa |
AA Sequence : | MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFGSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NUTF2 nuclear transport factor 2 [ Homo sapiens (human) ] |
Official Symbol | NUTF2 |
Synonyms | NUTF2; nuclear transport factor 2; NTF2; PP15; NTF-2; placental protein 15; |
Gene ID | 10204 |
mRNA Refseq | NM_005796 |
Protein Refseq | NP_005787 |
MIM | 605813 |
UniProt ID | P61970 |
◆ Recombinant Proteins | ||
NUTF2-1566H | Recombinant Human NUTF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUTF2-3863H | Recombinant Human NUTF2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NUTF2-2542H | Recombinant Human Nuclear Transport Factor 2 | +Inquiry |
NUTF2-1520Z | Recombinant Zebrafish NUTF2 | +Inquiry |
NUTF2-2047HFL | Recombinant Full Length Human NUTF2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUTF2-448HCL | Recombinant Human NUTF2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUTF2 Products
Required fields are marked with *
My Review for All NUTF2 Products
Required fields are marked with *
0
Inquiry Basket