Recombinant Human NUTF2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NUTF2-3863H
Product Overview : NUTF2 MS Standard C13 and N15-labeled recombinant protein (NP_005787) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a cytosolic factor that facilitates protein transport into the nucleus. The encoded protein is required for nuclear import of the small Ras-like GTPase, Ran which is involved in numerous cellular processes. This protein also interacts with the nuclear pore complex glycoprotein p62.
Molecular Mass : 14.5 kDa
AA Sequence : MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFGSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NUTF2 nuclear transport factor 2 [ Homo sapiens (human) ]
Official Symbol NUTF2
Synonyms NUTF2; nuclear transport factor 2; NTF2; PP15; NTF-2; placental protein 15;
Gene ID 10204
mRNA Refseq NM_005796
Protein Refseq NP_005787
MIM 605813
UniProt ID P61970

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUTF2 Products

Required fields are marked with *

My Review for All NUTF2 Products

Required fields are marked with *

0
cart-icon
0
compare icon