Recombinant Human NXNL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NXNL1-3922H |
Product Overview : | NXNL1 MS Standard C13 and N15-labeled recombinant protein (NP_612463) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Retinitis pigmentosa (RP) is a disease that leads to blindness by degeneration of cone photoreceptors. Rods produce factors required for cone viability. The protein encoded by this gene is one of those factors and is similar to a truncated form of thioredoxin. This gene has been proposed to have therapeutic value against RP. |
Molecular Mass : | 23.9 kDa |
AA Sequence : | MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGGLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NXNL1 nucleoredoxin-like 1 [ Homo sapiens (human) ] |
Official Symbol | NXNL1 |
Synonyms | NXNL1; nucleoredoxin-like 1; thioredoxin like 6, TXNL6; nucleoredoxin-like protein 1; RDCVF; thioredoxin-like 6; thioredoxin-like protein 6; rod-derived cone viability factor; TXNL6; |
Gene ID | 115861 |
mRNA Refseq | NM_138454 |
Protein Refseq | NP_612463 |
MIM | 608791 |
UniProt ID | Q96CM4 |
◆ Recombinant Proteins | ||
NXNL1-3922H | Recombinant Human NXNL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NXNL1-1568H | Recombinant Human NXNL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NXNL1-1970H | Recombinant Human NXNL1 Protein, MYC/DDK-tagged | +Inquiry |
NXNL1-2156HFL | Recombinant Full Length Human NXNL1 Protein, C-Flag-tagged | +Inquiry |
NXNL1-6287M | Recombinant Mouse NXNL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NXNL1-1240HCL | Recombinant Human NXNL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NXNL1 Products
Required fields are marked with *
My Review for All NXNL1 Products
Required fields are marked with *