Recombinant Human NXNL2 Protein (1-135 aa), His-SUMO-tagged

• Cat.No.: NXNL2-1034H
• Product Overview: Recombinant Human NXNL2 Protein (1-135 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Isoform 2.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-135 aa
• Description: May be involved in the maintenance of both the function and the viability of sensory neurons, including photoreceptors and olfactory neurons.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 30.7 kDa
• AA Sequence: MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFVSADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHCNLCLLGSSDSLALAS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: NXNL2 nucleoredoxin-like 2 [ Homo sapiens ]
• Official Symbol: NXNL2
• Synonyms: NXNL2; nucleoredoxin-like 2; RDCVF2; C9orf121
• Gene ID: 158046
• mRNA Refseq: NM_001161625
• Protein Refseq: NP_001155097
• UniProt ID: Q5VZ03