Recombinant Human NXNL2 Protein (1-135 aa), His-SUMO-tagged
| Cat.No. : | NXNL2-1034H |
| Product Overview : | Recombinant Human NXNL2 Protein (1-135 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-135 aa |
| Description : | May be involved in the maintenance of both the function and the viability of sensory neurons, including photoreceptors and olfactory neurons. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 30.7 kDa |
| AA Sequence : | MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFVSADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHCNLCLLGSSDSLALAS |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | NXNL2 nucleoredoxin-like 2 [ Homo sapiens ] |
| Official Symbol | NXNL2 |
| Synonyms | NXNL2; nucleoredoxin-like 2; RDCVF2; C9orf121; |
| Gene ID | 158046 |
| mRNA Refseq | NM_001161625 |
| Protein Refseq | NP_001155097 |
| UniProt ID | Q5VZ03 |
| ◆ Recombinant Proteins | ||
| NXNL2-1034H | Recombinant Human NXNL2 Protein (1-135 aa), His-SUMO-tagged | +Inquiry |
| NXNL2-1919Z | Recombinant Zebrafish NXNL2 | +Inquiry |
| NXNL2-11020M | Recombinant Mouse NXNL2 Protein | +Inquiry |
| NXNL2-6288M | Recombinant Mouse NXNL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NXNL2-3620HCL | Recombinant Human NXNL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NXNL2 Products
Required fields are marked with *
My Review for All NXNL2 Products
Required fields are marked with *
