Recombinant Human NXNL2 Protein (1-135 aa), His-SUMO-tagged
Cat.No. : | NXNL2-1034H |
Product Overview : | Recombinant Human NXNL2 Protein (1-135 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-135 aa |
Description : | May be involved in the maintenance of both the function and the viability of sensory neurons, including photoreceptors and olfactory neurons. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 30.7 kDa |
AA Sequence : | MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFVSADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHCNLCLLGSSDSLALAS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | NXNL2 nucleoredoxin-like 2 [ Homo sapiens ] |
Official Symbol | NXNL2 |
Synonyms | NXNL2; nucleoredoxin-like 2; RDCVF2; C9orf121; |
Gene ID | 158046 |
mRNA Refseq | NM_001161625 |
Protein Refseq | NP_001155097 |
UniProt ID | Q5VZ03 |
◆ Recombinant Proteins | ||
NXNL2-1034H | Recombinant Human NXNL2 Protein (1-135 aa), His-SUMO-tagged | +Inquiry |
NXNL2-1919Z | Recombinant Zebrafish NXNL2 | +Inquiry |
NXNL2-6288M | Recombinant Mouse NXNL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NXNL2-11020M | Recombinant Mouse NXNL2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NXNL2-3620HCL | Recombinant Human NXNL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NXNL2 Products
Required fields are marked with *
My Review for All NXNL2 Products
Required fields are marked with *
0
Inquiry Basket