Recombinant Human NXT1, His-tagged

Cat.No. : NXT1-29564TH
Product Overview : Recombinant full-length Human NXT1 with a N terminal His tag; 160 amino acids, predicted molecular weight 18 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 160 amino acids
Description : The protein encoded by this gene is located in the nuclear envelope. It has protein similarity to nuclear transport factor 2. This protein functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. The encoded protein heterodimerizes with Tap protein and may regulate the ability of Tap protein to mediate nuclear mRNA export. The use of alternate polyadenylation sites has been found for this gene.
Conjugation : HIS
Molecular Weight : 18.000kDa inclusive of tags
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS
Sequence Similarities : Contains 1 NTF2 domain.
Gene Name NXT1 NTF2-like export factor 1 [ Homo sapiens ]
Official Symbol NXT1
Synonyms NXT1; NTF2-like export factor 1; NTX2 like export factor1; NTF2-related export protein 1; MTR2; P15;
Gene ID 29107
mRNA Refseq NM_013248
Protein Refseq NP_037380
MIM 605811
Uniprot ID Q9UKK6
Chromosome Location 20p12-p11.2
Pathway Exon junction complex (EJC), organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem;
Function Ran GTPase binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NXT1 Products

Required fields are marked with *

My Review for All NXT1 Products

Required fields are marked with *

0
cart-icon