Recombinant Human NXT1, His-tagged
| Cat.No. : | NXT1-29564TH |
| Product Overview : | Recombinant full-length Human NXT1 with a N terminal His tag; 160 amino acids, predicted molecular weight 18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 160 amino acids |
| Description : | The protein encoded by this gene is located in the nuclear envelope. It has protein similarity to nuclear transport factor 2. This protein functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. The encoded protein heterodimerizes with Tap protein and may regulate the ability of Tap protein to mediate nuclear mRNA export. The use of alternate polyadenylation sites has been found for this gene. |
| Conjugation : | HIS |
| Molecular Weight : | 18.000kDa inclusive of tags |
| Form : | Liquid |
| Purity : | by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS |
| Sequence Similarities : | Contains 1 NTF2 domain. |
| Gene Name | NXT1 NTF2-like export factor 1 [ Homo sapiens ] |
| Official Symbol | NXT1 |
| Synonyms | NXT1; NTF2-like export factor 1; NTX2 like export factor1; NTF2-related export protein 1; MTR2; P15; |
| Gene ID | 29107 |
| mRNA Refseq | NM_013248 |
| Protein Refseq | NP_037380 |
| MIM | 605811 |
| Uniprot ID | Q9UKK6 |
| Chromosome Location | 20p12-p11.2 |
| Pathway | Exon junction complex (EJC), organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; |
| Function | Ran GTPase binding; protein binding; |
| ◆ Recombinant Proteins | ||
| NXT1-5172H | Recombinant Human NXT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NXT1-28306TH | Recombinant Human NXT1, T7 -tagged | +Inquiry |
| NXT1-29564TH | Recombinant Human NXT1, His-tagged | +Inquiry |
| NXT1-2951H | Recombinant Human NTF2-like Export Factor 1, T7-tagged | +Inquiry |
| NXT1-2963R | Recombinant Rhesus Macaque NXT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NXT1-3618HCL | Recombinant Human NXT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NXT1 Products
Required fields are marked with *
My Review for All NXT1 Products
Required fields are marked with *
