Recombinant Human OAF Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | OAF-1784H |
Product Overview : | OAF MS Standard C13 and N15-labeled recombinant protein (NP_848602) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | OAF (Out At First Homolog) is a Protein Coding gene. Diseases associated with OAF include Acute Maxillary Sinusitis and Alveolar Periostitis. |
Molecular Mass : | 30.7 kDa |
AA Sequence : | MRLPGVPLARPALLLLLPLLAPLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVSFTADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKLRQKNPRAVRQAEEVRGLEHLHMDVAVNFSQGALLSPHLHNVCAEAVDAIYTRQEDVRFWLEQGVDSSVFEALPKASEQAELPRCRQVGDHGKPCVCRYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQRQLCLWDEDPYPGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | OAF out at first homolog [ Homo sapiens (human) ] |
Official Symbol | OAF |
Synonyms | OAF; OAF homolog (Drosophila); out at first protein homolog; MGC52117; HCV NS5A-transactivated protein 13 target protein 2; NS5ATP13TP2; |
Gene ID | 220323 |
mRNA Refseq | NM_178507 |
Protein Refseq | NP_848602 |
UniProt ID | Q86UD1 |
◆ Recombinant Proteins | ||
OAF-6292M | Recombinant Mouse OAF Protein, His (Fc)-Avi-tagged | +Inquiry |
OAF-1784H | Recombinant Human OAF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
OAF-3147R | Recombinant Rhesus monkey OAF Protein, His-tagged | +Inquiry |
OAF-576H | Recombinant Human OAF protein(Met1-Gly273), His-tagged | +Inquiry |
OAF-3803R | Recombinant Rat OAF Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OAF-3616HCL | Recombinant Human OAF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OAF Products
Required fields are marked with *
My Review for All OAF Products
Required fields are marked with *