Recombinant Human OAF Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : OAF-1784H
Product Overview : OAF MS Standard C13 and N15-labeled recombinant protein (NP_848602) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : OAF (Out At First Homolog) is a Protein Coding gene. Diseases associated with OAF include Acute Maxillary Sinusitis and Alveolar Periostitis.
Molecular Mass : 30.7 kDa
AA Sequence : MRLPGVPLARPALLLLLPLLAPLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVSFTADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKLRQKNPRAVRQAEEVRGLEHLHMDVAVNFSQGALLSPHLHNVCAEAVDAIYTRQEDVRFWLEQGVDSSVFEALPKASEQAELPRCRQVGDHGKPCVCRYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQRQLCLWDEDPYPGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name OAF out at first homolog [ Homo sapiens (human) ]
Official Symbol OAF
Synonyms OAF; OAF homolog (Drosophila); out at first protein homolog; MGC52117; HCV NS5A-transactivated protein 13 target protein 2; NS5ATP13TP2;
Gene ID 220323
mRNA Refseq NM_178507
Protein Refseq NP_848602
UniProt ID Q86UD1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OAF Products

Required fields are marked with *

My Review for All OAF Products

Required fields are marked with *

0
cart-icon