Recombinant Human OAF Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | OAF-1784H |
| Product Overview : | OAF MS Standard C13 and N15-labeled recombinant protein (NP_848602) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | OAF (Out At First Homolog) is a Protein Coding gene. Diseases associated with OAF include Acute Maxillary Sinusitis and Alveolar Periostitis. |
| Molecular Mass : | 30.7 kDa |
| AA Sequence : | MRLPGVPLARPALLLLLPLLAPLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVSFTADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKLRQKNPRAVRQAEEVRGLEHLHMDVAVNFSQGALLSPHLHNVCAEAVDAIYTRQEDVRFWLEQGVDSSVFEALPKASEQAELPRCRQVGDHGKPCVCRYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQRQLCLWDEDPYPGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | OAF out at first homolog [ Homo sapiens (human) ] |
| Official Symbol | OAF |
| Synonyms | OAF; OAF homolog (Drosophila); out at first protein homolog; MGC52117; HCV NS5A-transactivated protein 13 target protein 2; NS5ATP13TP2; |
| Gene ID | 220323 |
| mRNA Refseq | NM_178507 |
| Protein Refseq | NP_848602 |
| UniProt ID | Q86UD1 |
| ◆ Recombinant Proteins | ||
| Oaf-218M | Recombinant Mouse Oaf Protein, MYC/DDK-tagged | +Inquiry |
| OAF-1433H | Recombinant Human OAF, His-tagged | +Inquiry |
| OAF-4141R | Recombinant Rat OAF Protein | +Inquiry |
| OAF-1784H | Recombinant Human OAF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| OAF-11033M | Recombinant Mouse OAF Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OAF-3616HCL | Recombinant Human OAF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OAF Products
Required fields are marked with *
My Review for All OAF Products
Required fields are marked with *
