Recombinant Human OAS1, His-tagged
Cat.No. : | OAS1-27767TH |
Product Overview : | Recombinant full length Human OAS1, isoform p41 with N terminal His tag; 384 amino acids with a predicted MWt 43.9kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 364 amino acids |
Description : | This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2-specific nucleotidyl transfer reactions to synthesize 2,5-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described. |
Conjugation : | HIS |
Molecular Weight : | 43.900kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT |
Storage : | Please see Notes section |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMMDLRNTPAKSLDKFIEDYL LPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVK GGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQ EIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQ LGEGVEFDVLPAFDALGQLTGSYKPNPQIYVKLIEECTDL QKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCK KKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLE LVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILD PADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPV SSWILLVRPPASSLPFIPAPLHEA |
Sequence Similarities : | Belongs to the 2-5A synthase family. |
Gene Name | OAS1 2-5-oligoadenylate synthetase 1, 40/46kDa [ Homo sapiens ] |
Official Symbol | OAS1 |
Synonyms | OAS1; 2-5-oligoadenylate synthetase 1, 40/46kDa; 2,5 oligoadenylate synthetase 1 (40 46 kD) , OIAS; 2-5-oligoadenylate synthase 1; IFI 4; OIASI; |
Gene ID | 4938 |
mRNA Refseq | NM_001032409 |
Protein Refseq | NP_001027581 |
Uniprot ID | P00973 |
Chromosome Location | 12q24.2 |
Pathway | Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; |
Function | 2-5-oligoadenylate synthetase activity; ATP binding; double-stranded RNA binding; nucleotide binding; nucleotidyltransferase activity; |
◆ Recombinant Proteins | ||
OAS1-2966R | Recombinant Rhesus Macaque OAS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OAS1-123R | Recombinant Rat OAS1 protein, His-T7-tagged | +Inquiry |
OAS1-378H | Recombinant Human 2,5-oligoadenylate Synthetase 1, 40/46kDa | +Inquiry |
OAS1-120H | Recombinant Human OAS1 protein, His-tagged | +Inquiry |
OAS1-122M | Recombinant Mouse OAS1 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OAS1-3615HCL | Recombinant Human OAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OAS1 Products
Required fields are marked with *
My Review for All OAS1 Products
Required fields are marked with *