Recombinant Human OBP2A protein, His-SUMO-tagged
| Cat.No. : | OBP2A-6742H |
| Product Overview : | Recombinant Human OBP2A protein(Q9NY56)(16-170aa(C114S,K127N)), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 16-170a.a.(C114S,K127N) |
| Tag : | His&SUMO |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.8 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYSKDQRRGGLRYMGNLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH |
| Gene Name | OBP2A odorant binding protein 2A [ Homo sapiens (human) ] |
| Official Symbol | OBP2A |
| Synonyms | OBP2A; OBP; OBP2C; OBPIIa; hOBPIIa; odorant binding protein 2A; odorant-binding protein 2a; odorant-binding protein Iia; putative odorant-binding protein 2c |
| Gene ID | 29991 |
| mRNA Refseq | NM_014582 |
| Protein Refseq | NP_055397 |
| MIM | 164320 |
| UniProt ID | Q9NY56 |
| ◆ Recombinant Proteins | ||
| OBP2A-1880H | Recombinant Human OBP2A Protein, His&GST-tagged | +Inquiry |
| OBP2A-1438H | Recombinant Human OBP2A, GST-tagged | +Inquiry |
| OBP2A-4843H | Recombinant Human OBP2A protein, His-SUMO-tagged | +Inquiry |
| OBP2A-5213HFL | Recombinant Full Length Human OBP2A protein, Flag-tagged | +Inquiry |
| OBP2A-6742H | Recombinant Human OBP2A protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OBP2A-3609HCL | Recombinant Human OBP2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OBP2A Products
Required fields are marked with *
My Review for All OBP2A Products
Required fields are marked with *
