Recombinant Human ODAM protein, His-tagged
Cat.No. : | ODAM-3300H |
Product Overview : | Recombinant Human ODAM protein(A1E959)(16-279aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 16-279aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.2 kDa |
AA Sequence : | APLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ODAM odontogenic, ameloblast asssociated [ Homo sapiens(human) ] |
Official Symbol | ODAM |
Synonyms | ODAM; APIN; odontogenic, ameloblast asssociated; odontogenic ameloblast-associated protein |
Gene ID | 54959 |
mRNA Refseq | NM_017855 |
Protein Refseq | NP_060325 |
MIM | 614843 |
UniProt ID | A1E959 |
◆ Recombinant Proteins | ||
ODAM-7313Z | Recombinant Zebrafish ODAM | +Inquiry |
ODAM-3155R | Recombinant Rhesus monkey ODAM Protein, His-tagged | +Inquiry |
ODAM-1443H | Recombinant Human ODAM, GST-tagged | +Inquiry |
ODAM-3817R | Recombinant Rat ODAM Protein, His (Fc)-Avi-tagged | +Inquiry |
ODAM-3300H | Recombinant Human ODAM protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ODAM-1244HCL | Recombinant Human ODAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ODAM Products
Required fields are marked with *
My Review for All ODAM Products
Required fields are marked with *
0
Inquiry Basket