Recombinant Human ODAM protein, His-tagged
| Cat.No. : | ODAM-3300H |
| Product Overview : | Recombinant Human ODAM protein(A1E959)(16-279aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 16-279aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 33.2 kDa |
| AA Sequence : | APLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ODAM odontogenic, ameloblast asssociated [ Homo sapiens(human) ] |
| Official Symbol | ODAM |
| Synonyms | ODAM; APIN; odontogenic, ameloblast asssociated; odontogenic ameloblast-associated protein |
| Gene ID | 54959 |
| mRNA Refseq | NM_017855 |
| Protein Refseq | NP_060325 |
| MIM | 614843 |
| UniProt ID | A1E959 |
| ◆ Recombinant Proteins | ||
| ODAM-2973R | Recombinant Rhesus Macaque ODAM Protein, His (Fc)-Avi-tagged | +Inquiry |
| ODAM-7313Z | Recombinant Zebrafish ODAM | +Inquiry |
| ODAM-3300H | Recombinant Human ODAM protein, His-tagged | +Inquiry |
| ODAM-1443H | Recombinant Human ODAM, GST-tagged | +Inquiry |
| ODAM-3155R | Recombinant Rhesus monkey ODAM Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ODAM-1244HCL | Recombinant Human ODAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ODAM Products
Required fields are marked with *
My Review for All ODAM Products
Required fields are marked with *



