Recombinant Human ODF2
Cat.No. : | ODF2-27389TH |
Product Overview : | Recombinant fragment of Human Cenexin1/ODF2 Isoform 3 with a N terminal proprietary tag: predicted molecular weight 36.52 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. This gene encodes one of the major outer dense fiber proteins. Alternative splicing results in multiple transcript variants. The longer transcripts, also known as Cenexins, encode proteins with a C-terminal extension that are differentially targeted to somatic centrioles and thought to be crucial for the formation of microtubule organizing centers. |
Molecular Weight : | 36.520kDa inclusive of tags |
Tissue specificity : | Testis-specific (at protein level). Highly expressed in cytoplasm of step 2 round spermatids. Detected in the middle piece and extends to about half the principal piece of the sperm tails. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP* |
Sequence Similarities : | Belongs to the ODF2 family. |
Gene Name | ODF2 outer dense fiber of sperm tails 2 [ Homo sapiens ] |
Official Symbol | ODF2 |
Synonyms | ODF2; outer dense fiber of sperm tails 2; outer dense fibre of sperm tails 2; outer dense fiber protein 2; cancer/testis antigen 134; CT134; ODF84; |
Gene ID | 4957 |
mRNA Refseq | NM_001242352 |
Protein Refseq | NP_001229281 |
MIM | 602015 |
Uniprot ID | Q5BJF6 |
Chromosome Location | 9q34 |
Pathway | Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem; Loss of proteins required for interphase microtubule organization??from the centrosome, organism-specific biosystem; |
Function | protein binding; structural molecule activity; |
◆ Recombinant Proteins | ||
ODF2-11073M | Recombinant Mouse ODF2 Protein | +Inquiry |
ODF2-6314M | Recombinant Mouse ODF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Odf2-4573M | Recombinant Mouse Odf2 Protein, Myc/DDK-tagged | +Inquiry |
ODF2-2027C | Recombinant Chicken ODF2 | +Inquiry |
ODF2-27389TH | Recombinant Human ODF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ODF2-3598HCL | Recombinant Human ODF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ODF2 Products
Required fields are marked with *
My Review for All ODF2 Products
Required fields are marked with *