Recombinant Human OLAH Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | OLAH-5297H |
Product Overview : | OLAH MS Standard C13 and N15-labeled recombinant protein (NP_001034791) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | OLAH (Oleoyl-ACP Hydrolase) is a Protein Coding gene. Diseases associated with OLAH include Rheumatoid Arthritis and Arthritis. Among its related pathways are Fatty acid biosynthesis (KEGG) and Metabolism. Gene Ontology (GO) annotations related to this gene include hydrolase activity, acting on ester bonds and myristoyl-[acyl-carrier-protein] hydrolase activity. |
Molecular Mass : | 29.9 kDa |
AA Sequence : | MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | OLAH oleoyl-ACP hydrolase [ Homo sapiens (human) ] |
Official Symbol | OLAH |
Synonyms | OLAH; oleoyl-ACP hydrolase; THEDC1, thioesterase domain containing 1; S-acyl fatty acid synthase thioesterase, medium chain; FLJ11106; SAST; thioesterase II; thioesterase domain containing 1; augmented in rheumatoid arthritis 1; thioesterase domain-containing protein 1; AURA1; THEDC1; MGC51852; |
Gene ID | 55301 |
mRNA Refseq | NM_001039702 |
Protein Refseq | NP_001034791 |
UniProt ID | Q9NV23 |
◆ Recombinant Proteins | ||
OLAH-3827R | Recombinant Rat OLAH Protein, His (Fc)-Avi-tagged | +Inquiry |
OLAH-5297H | Recombinant Human OLAH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
OLAH-1451H | Recombinant Human OLAH protein, His-tagged | +Inquiry |
Olah-4587M | Recombinant Mouse Olah Protein, Myc/DDK-tagged | +Inquiry |
OLAH-4165R | Recombinant Rat OLAH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLAH-3585HCL | Recombinant Human OLAH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OLAH Products
Required fields are marked with *
My Review for All OLAH Products
Required fields are marked with *