Recombinant Human OLR1 Protein, His-tagged

Cat.No. : OLR1-01H
Product Overview : Recombinant human OLR1 (58-273aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : His
Protein Length : 58-273 a.a.
Description : This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.
Form : Liquid
Molecular Mass : 25.8 kDa (225aa)
AA Sequence : ADPMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQHHHHHH
Endotoxin : < 1.0 EU/μg of the protein by the LAL method.
Purity : > 95% as analyzed by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name OLR1 oxidized low density lipoprotein receptor 1 [ Homo sapiens (human) ]
Official Symbol OLR1
Synonyms OLR1; oxidized low density lipoprotein receptor 1; LOX1; LOXIN; SLOX1; CLEC8A; SCARE1; oxidized low-density lipoprotein receptor 1; C-type lectin domain family 8 member A; hLOX-1; lectin-type oxidized LDL receptor 1; ox LDL receptor 1; oxidized low density lipoprotein (lectin-like) receptor 1; oxidized low-density lipoprotein receptor 1, soluble form; scavenger receptor class E, member 1
Gene ID 4973
mRNA Refseq NM_002543
Protein Refseq NP_002534
MIM 602601
UniProt ID P78380

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OLR1 Products

Required fields are marked with *

My Review for All OLR1 Products

Required fields are marked with *

0
cart-icon