Recombinant Human OLR1 Protein, His-tagged
Cat.No. : | OLR1-01H |
Product Overview : | Recombinant human OLR1 (58-273aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | His |
Protein Length : | 58-273 a.a. |
Description : | This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants. |
Form : | Liquid |
Molecular Mass : | 25.8 kDa (225aa) |
AA Sequence : | ADPMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQHHHHHH |
Endotoxin : | < 1.0 EU/μg of the protein by the LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | OLR1 oxidized low density lipoprotein receptor 1 [ Homo sapiens (human) ] |
Official Symbol | OLR1 |
Synonyms | OLR1; oxidized low density lipoprotein receptor 1; LOX1; LOXIN; SLOX1; CLEC8A; SCARE1; oxidized low-density lipoprotein receptor 1; C-type lectin domain family 8 member A; hLOX-1; lectin-type oxidized LDL receptor 1; ox LDL receptor 1; oxidized low density lipoprotein (lectin-like) receptor 1; oxidized low-density lipoprotein receptor 1, soluble form; scavenger receptor class E, member 1 |
Gene ID | 4973 |
mRNA Refseq | NM_002543 |
Protein Refseq | NP_002534 |
MIM | 602601 |
UniProt ID | P78380 |
◆ Recombinant Proteins | ||
OLR1-2984R | Recombinant Rhesus Macaque OLR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OLR1-6389M | Recombinant Mouse OLR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Olr1-358M | Recombinant Mouse Olr1 Protein, MYC/DDK-tagged | +Inquiry |
Olr1-1886M | Recombinant Mouse Olr1 protein, His & T7-tagged | +Inquiry |
OLR1-3631H | Recombinant Human OLR1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLR1-001RCL | Recombinant Rat OLR1 cell lysate | +Inquiry |
OLR1-1716HCL | Recombinant Human OLR1 cell lysate | +Inquiry |
OLR1-1170CCL | Recombinant Cynomolgus OLR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OLR1 Products
Required fields are marked with *
My Review for All OLR1 Products
Required fields are marked with *
0
Inquiry Basket