Recombinant Human OPRK1

• Cat.No.: OPRK1-28446TH
• Product Overview: Recombinant fragment, corresponding to amino acids 1-58 of Human Kappa Opioid Receptor, with an N-terminal proprietary tag, 32.01 kDa inclusive of tag

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 58 amino acids
• Molecular Weight: 32.010kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAI
• Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.

Gene Information

• Gene Name: OPRK1 opioid receptor, kappa 1 [ Homo sapiens ]
• Official Symbol: OPRK1
• Synonyms: OPRK1; opioid receptor, kappa 1; kappa-type opioid receptor; KOR
• Gene ID: 4986
• mRNA Refseq: NM_000912
• Protein Refseq: NP_000903
• MIM: 165196
• Uniprot ID: P41145
• Chromosome Location: 8q11.2
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem
• Function: G-protein coupled receptor activity; protein binding; receptor activity; signal transducer activity