Recombinant Human OPRK1

Cat.No. : OPRK1-28446TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-58 of Human Kappa Opioid Receptor, with an N-terminal proprietary tag, 32.01 kDa inclusive of tag
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 58 amino acids
Molecular Weight : 32.010kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAI
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name OPRK1 opioid receptor, kappa 1 [ Homo sapiens ]
Official Symbol OPRK1
Synonyms OPRK1; opioid receptor, kappa 1; kappa-type opioid receptor; KOR;
Gene ID 4986
mRNA Refseq NM_000912
Protein Refseq NP_000903
MIM 165196
Uniprot ID P41145
Chromosome Location 8q11.2
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function G-protein coupled receptor activity; protein binding; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OPRK1 Products

Required fields are marked with *

My Review for All OPRK1 Products

Required fields are marked with *

0
cart-icon