Recombinant Human OPRM1 protein, GST-tagged

• Cat.No.: OPRM1-301348H
• Product Overview: Recombinant Human OPRM1 (1-68 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Ile68
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCPPTGSPSMI
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: OPRM1 opioid receptor, mu 1 [ Homo sapiens ]
• Official Symbol: OPRM1
• Synonyms: OPRM1; opioid receptor, mu 1; mu-type opioid receptor; MOR1; MOP; hMOP; M-OR-1; mu opiate receptor; mu opioid receptor hMOR-1a; mu opioid receptor splice variant hMOR-1S; mu opioid receptor splice variant hMOR-1Z; mu opioid receptor splice variant hMOR-1b; mu opioid receptor splice variant hMOR-1Y2; mu opioid receptor splice variant hMOR-1Y3; MOR; LMOR; OPRM; KIAA0403
• Gene ID: 4988
• mRNA Refseq: NM_000914
• Protein Refseq: NP_000905
• MIM: 600018
• UniProt ID: P35372