Recombinant Human OPRM1 protein, GST-tagged

Cat.No. : OPRM1-301348H
Product Overview : Recombinant Human OPRM1 (1-68 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Ile68
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCPPTGSPSMI
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name OPRM1 opioid receptor, mu 1 [ Homo sapiens ]
Official Symbol OPRM1
Synonyms OPRM1; opioid receptor, mu 1; mu-type opioid receptor; MOR1; MOP; hMOP; M-OR-1; mu opiate receptor; mu opioid receptor hMOR-1a; mu opioid receptor splice variant hMOR-1S; mu opioid receptor splice variant hMOR-1Z; mu opioid receptor splice variant hMOR-1b; mu opioid receptor splice variant hMOR-1Y2; mu opioid receptor splice variant hMOR-1Y3; MOR; LMOR; OPRM; KIAA0403;
Gene ID 4988
mRNA Refseq NM_000914
Protein Refseq NP_000905
MIM 600018
UniProt ID P35372

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OPRM1 Products

Required fields are marked with *

My Review for All OPRM1 Products

Required fields are marked with *

0
cart-icon
0
compare icon