Recombinant Human ORAI1 protein, GST-tagged
| Cat.No. : | ORAI1-301514H |
| Product Overview : | Recombinant Human ORAI1 (1-75 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Ser75 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHSMQALS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | ORAI1 ORAI calcium release-activated calcium modulator 1 [ Homo sapiens ] |
| Official Symbol | ORAI1 |
| Synonyms | ORAI1; ORAI calcium release-activated calcium modulator 1; TMEM142A, transmembrane protein 142A; calcium release-activated calcium channel protein 1; calcium release activated calcium modulator 1; CRACM1; FLJ14466; protein orai-1; transmembrane protein 142A; calcium release-activated calcium modulator 1; ORAT1; TMEM142A; |
| Gene ID | 84876 |
| mRNA Refseq | NM_032790 |
| Protein Refseq | NP_116179 |
| MIM | 610277 |
| UniProt ID | Q96D31 |
| ◆ Recombinant Proteins | ||
| ORAI1-301514H | Recombinant Human ORAI1 protein, GST-tagged | +Inquiry |
| RFL10144HF | Recombinant Full Length Human Calcium Release-Activated Calcium Channel Protein 1(Orai1) Protein, His-Tagged | +Inquiry |
| ORAI1-5764H | Recombinant Human ORAI1 protein, His-tagged | +Inquiry |
| ORAI1-2364C | Recombinant Chicken ORAI1 | +Inquiry |
| ORAI1-3767H | Recombinant Human ORAI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ORAI1 Products
Required fields are marked with *
My Review for All ORAI1 Products
Required fields are marked with *
