Recombinant Human ORAI1 protein, GST-tagged

• Cat.No.: ORAI1-301514H
• Product Overview: Recombinant Human ORAI1 (1-75 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Ser75
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHSMQALS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: ORAI1 ORAI calcium release-activated calcium modulator 1 [ Homo sapiens ]
• Official Symbol: ORAI1
• Synonyms: ORAI1; ORAI calcium release-activated calcium modulator 1; TMEM142A, transmembrane protein 142A; calcium release-activated calcium channel protein 1; calcium release activated calcium modulator 1; CRACM1; FLJ14466; protein orai-1; transmembrane protein 142A; calcium release-activated calcium modulator 1; ORAT1; TMEM142A
• Gene ID: 84876
• mRNA Refseq: NM_032790
• Protein Refseq: NP_116179
• MIM: 610277
• UniProt ID: Q96D31