Recombinant Human ORC1
Cat.No. : | ORC1-30513TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1-110 of Human ORC1 with proprietary tag; Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is the largest subunit of the ORC complex. While other ORC subunits are stable throughout the cell cycle, the levels of this protein vary during the cell cycle, which has been shown to be controlled by ubiquitin-mediated proteolysis after initiation of DNA replication. This protein is found to be selectively phosphorylated during mitosis. It is also reported to interact with MYST histone acetyltransferase 2 (MyST2/HBO1), a protein involved in control of transcription silencing. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAHYPTRLTTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQ |
Sequence Similarities : | Belongs to the ORC1 family.Contains 1 BAH domain. |
Gene Name | ORC1 origin recognition complex, subunit 1 [ Homo sapiens ] |
Official Symbol | ORC1 |
Synonyms | ORC1; origin recognition complex, subunit 1; ORC1L, origin recognition complex, subunit 1 (yeast homolog) like , origin recognition complex, subunit 1 homolog (S. cerevisiae) , origin recognition complex, subunit 1 like (yeast); origin recognition comp |
Gene ID | 4998 |
mRNA Refseq | NM_001190818 |
Protein Refseq | NP_001177747 |
MIM | 601902 |
Uniprot ID | Q13415 |
Chromosome Location | 1p32 |
Pathway | Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the ORC complex at the origin of replication, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; Association of licensing factors with the pre-replicative complex, organism-specific biosystem; |
Function | ATP binding; DNA binding; nucleoside-triphosphatase activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
ORC1-30513TH | Recombinant Human ORC1 | +Inquiry |
ORC1-3861R | Recombinant Rat ORC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ORC1-01H | Recombinant Human ORC1 Protein, GST-tagged | +Inquiry |
ORC1-322H | Recombinant Human ORC1 protein, GST-tagged | +Inquiry |
ORC1-10300Z | Recombinant Zebrafish ORC1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ORC1 Products
Required fields are marked with *
My Review for All ORC1 Products
Required fields are marked with *
0
Inquiry Basket