Recombinant Human OSBPL5 protein, His-tagged
| Cat.No. : | OSBPL5-202H |
| Product Overview : | Recombinant Human OSBPL5 protein(1-353 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-353 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MKEEAFLRRRFSLCPPSSTPQKVDPRKLTRNLLLSGDNELYPLSPGKDMEPNGPSLPRDEGPPTPSSATKVPPAEYRLCNGSDKECVSPTARVTKKETLKAQKENYRQEKKRATRQLLSALTDPSVVIMADSLKGPKGESVGSITQPLPSSYLIFRAASESDGRCWLDALELALRCSSLLRLGTCKPGRDGEPGTSPDASPSSLCGLPASATVHPDQDLFPLNGSSLENDAFSDKSERENPEESDTETQDHSRKTESGSDQSETPGAPVRRGTTYVEQVQEELGELGEASQVETVSEENKSLMWTLLKQLRPGMDLSRVVLPTFVLEPRSFLNKLSDYYYHADLLSRAAVEED |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | OSBPL5 |
| Synonyms | OSBPL5; oxysterol binding protein-like 5; oxysterol-binding protein-related protein 5; KIAA1534; ORP5; ORP-5; OSBP-related protein 5; oxysterol-binding protein homolog 1; oxysterol-binding protein homologue 1; OBPH1; FLJ42929; |
| Gene ID | 114879 |
| mRNA Refseq | NM_001144063 |
| Protein Refseq | NP_001137535 |
| MIM | 606733 |
| UniProt ID | Q9H0X9 |
| ◆ Recombinant Proteins | ||
| OSBPL5-202H | Recombinant Human OSBPL5 protein, His-tagged | +Inquiry |
| OSBPL5-12202M | Recombinant Mouse OSBPL5 Protein | +Inquiry |
| Osbpl5-4611M | Recombinant Mouse Osbpl5 Protein, Myc/DDK-tagged | +Inquiry |
| OSBPL5-2013H | Recombinant Human OSBPL5 protein, His-tagged | +Inquiry |
| OSBPL5-6413M | Recombinant Mouse OSBPL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OSBPL5-3534HCL | Recombinant Human OSBPL5 293 Cell Lysate | +Inquiry |
| OSBPL5-3533HCL | Recombinant Human OSBPL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OSBPL5 Products
Required fields are marked with *
My Review for All OSBPL5 Products
Required fields are marked with *



