Recombinant Human OSBPL5 protein, His-tagged
Cat.No. : | OSBPL5-202H |
Product Overview : | Recombinant Human OSBPL5 protein(1-353 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-353 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MKEEAFLRRRFSLCPPSSTPQKVDPRKLTRNLLLSGDNELYPLSPGKDMEPNGPSLPRDEGPPTPSSATKVPPAEYRLCNGSDKECVSPTARVTKKETLKAQKENYRQEKKRATRQLLSALTDPSVVIMADSLKGPKGESVGSITQPLPSSYLIFRAASESDGRCWLDALELALRCSSLLRLGTCKPGRDGEPGTSPDASPSSLCGLPASATVHPDQDLFPLNGSSLENDAFSDKSERENPEESDTETQDHSRKTESGSDQSETPGAPVRRGTTYVEQVQEELGELGEASQVETVSEENKSLMWTLLKQLRPGMDLSRVVLPTFVLEPRSFLNKLSDYYYHADLLSRAAVEED |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | OSBPL5 |
Synonyms | OSBPL5; oxysterol binding protein-like 5; oxysterol-binding protein-related protein 5; KIAA1534; ORP5; ORP-5; OSBP-related protein 5; oxysterol-binding protein homolog 1; oxysterol-binding protein homologue 1; OBPH1; FLJ42929; |
Gene ID | 114879 |
mRNA Refseq | NM_001144063 |
Protein Refseq | NP_001137535 |
MIM | 606733 |
UniProt ID | Q9H0X9 |
◆ Recombinant Proteins | ||
Osbpl5-4611M | Recombinant Mouse Osbpl5 Protein, Myc/DDK-tagged | +Inquiry |
OSBPL5-12202M | Recombinant Mouse OSBPL5 Protein | +Inquiry |
OSBPL5-2013H | Recombinant Human OSBPL5 protein, His-tagged | +Inquiry |
OSBPL5-202H | Recombinant Human OSBPL5 protein, His-tagged | +Inquiry |
OSBPL5-4924H | Recombinant Human OSBPL5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSBPL5-3534HCL | Recombinant Human OSBPL5 293 Cell Lysate | +Inquiry |
OSBPL5-3533HCL | Recombinant Human OSBPL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OSBPL5 Products
Required fields are marked with *
My Review for All OSBPL5 Products
Required fields are marked with *
0
Inquiry Basket