Recombinant Human OSTN Protein, 28-133aa, C-6×His tagged

Cat.No. : OSTN-40H
Product Overview : Recombinant human Osteocrin, fused to His-tag at C-terminus, was expressed in HEK 293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 28-133aa
Description : Osteocrin, also known as Musclin, shows a well conserved homology with members of the natriuretic peptide (NP) family. It is a secreted protein that is expressed in muscle and bone. Based on similarities with NPs, Osteocrin could interact with the NP clearance receptors, importantly increasing CNP which has been shown to stimulate endochondral ossification and elongate bones. It is represents a novel, unique vitamin D-regulated bone-specific.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Human NPRC. The ED50 range ≤ 20 ng/mL.
Molecular Mass : 12.5 kDa (112aa)
AA Sequence : VDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG
Endotoxin : < 1.0 EU/μg of the protein by the LAL method.
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
References : 1. Thomas, G., et al, (2003) J. Biol. Chem. 278:50563–50571.
2. Nishizawa H., et al, (2004) J Biol Chem. 279:19391-19395.
3. Pierre Moffatt., et al, (2007) J Biol Chem. 282:36454-36462.
Gene Name OSTN osteocrin [ Homo sapiens (human) ]
Official Symbol OSTN
Synonyms OSTN; osteocrin; MUSCLIN;
Gene ID 344901
mRNA Refseq NM_198184
Protein Refseq NP_937827
MIM 610280
UniProt ID P61366

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OSTN Products

Required fields are marked with *

My Review for All OSTN Products

Required fields are marked with *

0
cart-icon
0
compare icon