Recombinant Human OSTN Protein, 28-133aa, C-6×His tagged
| Cat.No. : | OSTN-40H |
| Product Overview : | Recombinant human Osteocrin, fused to His-tag at C-terminus, was expressed in HEK 293 cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 28-133aa |
| Description : | Osteocrin, also known as Musclin, shows a well conserved homology with members of the natriuretic peptide (NP) family. It is a secreted protein that is expressed in muscle and bone. Based on similarities with NPs, Osteocrin could interact with the NP clearance receptors, importantly increasing CNP which has been shown to stimulate endochondral ossification and elongate bones. It is represents a novel, unique vitamin D-regulated bone-specific. |
| Form : | Liquid |
| Bio-activity : | Measured by its binding ability in a functional ELISA with Human NPRC. The ED50 range ≤ 20 ng/mL. |
| Molecular Mass : | 12.5 kDa (112aa) |
| AA Sequence : | VDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG |
| Endotoxin : | < 1.0 EU/μg of the protein by the LAL method. |
| Purity : | > 95% by SDS-PAGE |
| Applications : | SDS-PAGE, Bioactivity |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 0.5 mg/mL (determined by Bradford assay) |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| References : | 1. Thomas, G., et al, (2003) J. Biol. Chem. 278:50563–50571. 2. Nishizawa H., et al, (2004) J Biol Chem. 279:19391-19395. 3. Pierre Moffatt., et al, (2007) J Biol Chem. 282:36454-36462. |
| Gene Name | OSTN osteocrin [ Homo sapiens (human) ] |
| Official Symbol | OSTN |
| Synonyms | OSTN; osteocrin; MUSCLIN; |
| Gene ID | 344901 |
| mRNA Refseq | NM_198184 |
| Protein Refseq | NP_937827 |
| MIM | 610280 |
| UniProt ID | P61366 |
| ◆ Recombinant Proteins | ||
| OSTN-168H | Recombinant Human Osteocrin, His-tagged | +Inquiry |
| OSTN-12223M | Recombinant Mouse OSTN Protein | +Inquiry |
| OSTN-3502H | Recombinant Human OSTN, His-tagged | +Inquiry |
| OSTN-3710C | Recombinant Chicken OSTN | +Inquiry |
| OSTN-1904R | Recombinant Rat OSTN Protein (82-131 aa), His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OSTN-3519HCL | Recombinant Human OSTN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OSTN Products
Required fields are marked with *
My Review for All OSTN Products
Required fields are marked with *
