Recombinant Rat OSTN Protein (82-131 aa), His-SUMO-tagged
| Cat.No. : | OSTN-1904R |
| Product Overview : | Recombinant Rat OSTN Protein (82-131 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 82-131 aa |
| Description : | Appears to modulate osteoblastic differentiation. Could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 21.6 kDa |
| AA Sequence : | SFSGFGSPLDRLSAGSVEHRGKQRRVVDHSKKRFGIPMDRIGRNRLSSSR |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Ostn osteocrin [ Rattus norvegicus ] |
| Official Symbol | OSTN |
| Synonyms | OSTN; osteocrin; musclin; |
| Gene ID | 360730 |
| mRNA Refseq | NM_207612 |
| Protein Refseq | NP_997495 |
| UniProt ID | P61365 |
| ◆ Recombinant Proteins | ||
| OSTN-3710C | Recombinant Chicken OSTN | +Inquiry |
| OSTN-3876R | Recombinant Rat OSTN Protein, His (Fc)-Avi-tagged | +Inquiry |
| OSTN-1904R | Recombinant Rat OSTN Protein (82-131 aa), His-SUMO-tagged | +Inquiry |
| OSTN-168H | Recombinant Human Osteocrin, His-tagged | +Inquiry |
| OSTN-12223M | Recombinant Mouse OSTN Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OSTN-3519HCL | Recombinant Human OSTN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OSTN Products
Required fields are marked with *
My Review for All OSTN Products
Required fields are marked with *




