Recombinant Rat OSTN Protein (82-131 aa), His-SUMO-tagged
Cat.No. : | OSTN-1904R |
Product Overview : | Recombinant Rat OSTN Protein (82-131 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 82-131 aa |
Description : | Appears to modulate osteoblastic differentiation. Could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 21.6 kDa |
AA Sequence : | SFSGFGSPLDRLSAGSVEHRGKQRRVVDHSKKRFGIPMDRIGRNRLSSSR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Ostn osteocrin [ Rattus norvegicus ] |
Official Symbol | OSTN |
Synonyms | OSTN; osteocrin; musclin; |
Gene ID | 360730 |
mRNA Refseq | NM_207612 |
Protein Refseq | NP_997495 |
UniProt ID | P61365 |
◆ Recombinant Proteins | ||
OSTN-4214R | Recombinant Rat OSTN Protein | +Inquiry |
OSTN-4250H | Recombinant Human OSTN Protein (Val28-Gly133), N-His tagged | +Inquiry |
OSTN-40H | Recombinant Human OSTN Protein, 28-133aa, C-6×His tagged | +Inquiry |
OSTN-6424M | Recombinant Mouse OSTN Protein, His (Fc)-Avi-tagged | +Inquiry |
OSTN-1904R | Recombinant Rat OSTN Protein (82-131 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSTN-3519HCL | Recombinant Human OSTN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OSTN Products
Required fields are marked with *
My Review for All OSTN Products
Required fields are marked with *
0
Inquiry Basket