Recombinant Human OTOGL Protein, GST-tagged
Cat.No. : | OTOGL-515H |
Product Overview : | Human C12orf64 full-length ORF ( AAI01017.1, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the otogelin family. This gene is expressed in the inner ear of vertebrates with the highest level of expression seen at the embryonic stage and lowest in adult. Knockdown studies in zebrafish suggest that this gene is essential for normal inner ear function. Mutations in this gene are associated with autosomal recessive deafness. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 51.8 kDa |
AA Sequence : | MIKYLEEDFCYAIECLEEKDNHTGFHTLNFTLVNCSKKCDVHQVYTPSPSDYGCCGTCKNVSCKFHMENGTSVVYAVGSTWHYNCTTYECVKTDEGAIILNYTMVCPPFNETECKMNEGIVKLYNEGCCKICKREERICQKVIIKSVIRKQDCMSQSPINVASCDGKCPSATIYNINIESHLRFCKCCRENGVRNLSVPLYCSGNGTEIMYTLQEPIDCTCQWN |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | OTOGL otogelin like [ Homo sapiens (human) ] |
Official Symbol | OTOGL |
Synonyms | DFNB84B; C12orf64 |
Gene ID | 283310 |
mRNA Refseq | NM_173591.3 |
Protein Refseq | NP_775862.3 |
MIM | 614925 |
UniProt ID | Q3ZCN5.5 |
◆ Recombinant Proteins | ||
Otogl-6760M | Recombinant Mouse Otogl Protein (Pro1507-Lys1727), N-His tagged | +Inquiry |
OTOGL-1319H | Recombinant Human OTOGL | +Inquiry |
OTOGL-515H | Recombinant Human OTOGL Protein, GST-tagged | +Inquiry |
Otogl-6761M | Recombinant Mouse Otogl Protein (Arg1507-Lys1727), N-His tagged | +Inquiry |
OTOGL-1762HF | Recombinant Full Length Human OTOGL Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OTOGL Products
Required fields are marked with *
My Review for All OTOGL Products
Required fields are marked with *
0
Inquiry Basket