Recombinant Human OTOR Protein (112 aa)

Cat.No. : OTOR-063O
Product Overview : Recombinant Human OTOR Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 112
Description : OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the MIA/OTOR family. Members of this family which also includes MIA, MIA2, and TANGO share a Src homology-3 (SH3)-like domain. OTOR is predominantly expressed in the cochlea of the inner-ear and to a lesser extent in fetal brain and in some cartilage tissues. OTOR appears to be involved in early chondrogenesis of the otic capsule, which is required for normal inner ear development and auditory function.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Data Not Available.
Molecular Mass : 12.7 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids.
AA Sequence : MVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
Endotoxin : Less than 1 EU/μg of rHuOTOR as determined by LAL method.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.
Gene Name OTOR otoraplin [ Homo sapiens ]
Official Symbol OTOR
Synonyms OTOR; otoraplin; FDP; MIAL; MIAL1; fibrocyte-derived protein; melanoma inhibitory activity-like protein; MGC126737; MGC126739;
Gene ID 56914
mRNA Refseq NM_020157
Protein Refseq NP_064542
MIM 606067
UniProt ID Q9NRC9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OTOR Products

Required fields are marked with *

My Review for All OTOR Products

Required fields are marked with *

0
cart-icon