Recombinant Mouse Otor protein, His-tagged
| Cat.No. : | Otor-4675M |
| Product Overview : | Recombinant Mouse Otor protein(Q9JIE3)(19-128aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 19-128aa |
| Tag : | C-His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 14.0 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | HGVFMDKLSSKKLCADEECVYTISLARAQEDYNAPDCRFIDVKKGQQIYVYSKLVTENGAGEFWAGSVYGDHQDEMGIVGYFPSNLVKEQRVYQEATKEIPTTDIDFFCE |
| Gene Name | Otor otoraplin [ Mus musculus ] |
| Official Symbol | Otor |
| Synonyms | OTOR; otoraplin; melanoma inhibitory activity-like protein; Fdp; MIA; MIAL; CDRAP; |
| Gene ID | 57329 |
| mRNA Refseq | NM_020595 |
| Protein Refseq | NP_065620 |
| ◆ Recombinant Proteins | ||
| OTOR-318O | Recombinant Human OTOR Protein (112 aa) | +Inquiry |
| OTOR-28851TH | Recombinant Human OTOR | +Inquiry |
| Otor-4675M | Recombinant Mouse Otor protein, His-tagged | +Inquiry |
| OTOR-210O | Recombinant Human OTOR Protein (111 aa) | +Inquiry |
| Otor-8009M | Recombinant Mouse Otor protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OTOR-3518HCL | Recombinant Human OTOR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Otor Products
Required fields are marked with *
My Review for All Otor Products
Required fields are marked with *



