Recombinant Mouse Otor protein, His-tagged
Cat.No. : | Otor-4675M |
Product Overview : | Recombinant Mouse Otor protein(Q9JIE3)(19-128aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 19-128aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 14.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | HGVFMDKLSSKKLCADEECVYTISLARAQEDYNAPDCRFIDVKKGQQIYVYSKLVTENGAGEFWAGSVYGDHQDEMGIVGYFPSNLVKEQRVYQEATKEIPTTDIDFFCE |
Gene Name | Otor otoraplin [ Mus musculus ] |
Official Symbol | Otor |
Synonyms | OTOR; otoraplin; melanoma inhibitory activity-like protein; Fdp; MIA; MIAL; CDRAP; |
Gene ID | 57329 |
mRNA Refseq | NM_020595 |
Protein Refseq | NP_065620 |
◆ Recombinant Proteins | ||
Otor-4675M | Recombinant Mouse Otor protein, His-tagged | +Inquiry |
OTOR-22H | Recombinant Human Otoraplin | +Inquiry |
Otor-4623M | Recombinant Mouse Otor Protein, Myc/DDK-tagged | +Inquiry |
OTOR-063O | Recombinant Human OTOR Protein (112 aa) | +Inquiry |
OTOR-318O | Recombinant Human OTOR Protein (112 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
OTOR-3518HCL | Recombinant Human OTOR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Otor Products
Required fields are marked with *
My Review for All Otor Products
Required fields are marked with *
0
Inquiry Basket