Recombinant Human OTOS Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: OTOS-5418H
• Product Overview: OTOS MS Standard C13 and N15-labeled recombinant protein (NP_683764) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Otospiralin is synthesized by nonsensory cells (fibrocytes) of the inner ear, and downregulation of otospiralin in guinea pigs leads to deafness.
• Molecular Mass: 9.9 kDa
• AA Sequence: MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAYPQIEDMARTFFAHFPLGSTLGFHVPYQEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: OTOS otospiralin [ Homo sapiens (human) ]
• Official Symbol: OTOS
• Synonyms: OTOS; otospiralin; OTOSP; otospiralin
• Gene ID: 150677
• mRNA Refseq: NM_148961
• Protein Refseq: NP_683764
• MIM: 607877
• UniProt ID: Q8NHW6