Recombinant Human OTOS Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | OTOS-5418H |
| Product Overview : | OTOS MS Standard C13 and N15-labeled recombinant protein (NP_683764) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Otospiralin is synthesized by nonsensory cells (fibrocytes) of the inner ear, and downregulation of otospiralin in guinea pigs leads to deafness. |
| Molecular Mass : | 9.9 kDa |
| AA Sequence : | MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAYPQIEDMARTFFAHFPLGSTLGFHVPYQEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | OTOS otospiralin [ Homo sapiens (human) ] |
| Official Symbol | OTOS |
| Synonyms | OTOS; otospiralin; OTOSP; otospiralin |
| Gene ID | 150677 |
| mRNA Refseq | NM_148961 |
| Protein Refseq | NP_683764 |
| MIM | 607877 |
| UniProt ID | Q8NHW6 |
| ◆ Recombinant Proteins | ||
| Otos-4624M | Recombinant Mouse Otos Protein, Myc/DDK-tagged | +Inquiry |
| OTOS-4217R | Recombinant Rat OTOS Protein | +Inquiry |
| OTOS-8512Z | Recombinant Zebrafish OTOS | +Inquiry |
| OTOS-3259R | Recombinant Rhesus monkey OTOS Protein, His-tagged | +Inquiry |
| OTOS-5418H | Recombinant Human OTOS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OTOS Products
Required fields are marked with *
My Review for All OTOS Products
Required fields are marked with *


