Recombinant Human OTX2 protein, His-SUMO-tagged
Cat.No. : | OTX2-3310H |
Product Overview : | Recombinant Human OTX2 protein(P32243)(1-297aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-297aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.4 kDa |
AA Sequence : | MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | OTX2 orthodenticle homeobox 2 [ Homo sapiens ] |
Official Symbol | OTX2 |
Synonyms | OTX2; orthodenticle homeobox 2; orthodenticle homolog 2 (Drosophila); homeobox protein OTX2; orthodenticle homolog 2; CPHD6; MCOPS5; MGC45000; |
Gene ID | 5015 |
mRNA Refseq | NM_021728 |
Protein Refseq | NP_068374 |
MIM | 600037 |
UniProt ID | P32243 |
◆ Recombinant Proteins | ||
OTX2-8848Z | Recombinant Zebrafish OTX2 | +Inquiry |
OTX2-26H | Recombinant Human OTX2 Protein, His-tagged | +Inquiry |
OTX2-390H | Recombinant Human OTX2 Protein, His-tagged | +Inquiry |
OTX2-4776H | Recombinant Human OTX2 Protein (Met1-Leu297), C-His tagged | +Inquiry |
OTX2-165H | Recombinant Human OTX2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
OTX2-3511HCL | Recombinant Human OTX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OTX2 Products
Required fields are marked with *
My Review for All OTX2 Products
Required fields are marked with *
0
Inquiry Basket