Recombinant Human OVCA2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | OVCA2-831H |
Product Overview : | OVCA2 MS Standard C13 and N15-labeled recombinant protein (NP_543012) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | OVCA2 (OVCA2 Serine Hydrolase Domain Containing) is a Protein Coding gene. Diseases associated with OVCA2 include Chromosome 17P13.3, Centromeric, Duplication Syndrome and Ovarian Cancer. Gene Ontology (GO) annotations related to this gene include hydrolase activity. |
Molecular Mass : | 24.4 kDa |
AA Sequence : | MAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSDFGSCPPEEQPRGWWFSEQEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQFAETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | OVCA2 ovarian tumor suppressor candidate 2 [ Homo sapiens (human) ] |
Official Symbol | OVCA2 |
Synonyms | OVCA2; ovarian tumor suppressor candidate 2; ovarian cancer-associated gene 2 protein; candidate tumor suppressor in ovarian cancer 2; ovarian cancer gene-2 protein; |
Gene ID | 124641 |
mRNA Refseq | NM_080822 |
Protein Refseq | NP_543012 |
MIM | 607896 |
UniProt ID | Q8WZ82 |
◆ Recombinant Proteins | ||
OVCA2-12249M | Recombinant Mouse OVCA2 Protein | +Inquiry |
OVCA2-6442M | Recombinant Mouse OVCA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
OVCA2-2743Z | Recombinant Zebrafish OVCA2 | +Inquiry |
OVCA2-1482H | Recombinant Human OVCA2 protein, GST-tagged | +Inquiry |
Ovca2-4630M | Recombinant Mouse Ovca2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OVCA2-3510HCL | Recombinant Human OVCA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OVCA2 Products
Required fields are marked with *
My Review for All OVCA2 Products
Required fields are marked with *