Recombinant Human OXCT1
| Cat.No. : | OXCT1-30531TH |
| Product Overview : | Recombinant fragment of Human OXCT1 with a N terminal proprietary tag: predicted molecular weight 31.57 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency. |
| Molecular Weight : | 31.570kDa inclusive of tags |
| Tissue specificity : | Abundant in heart, followed in order by kidney, brain, and muscle, whereas in liver it is undetectable; also detectable in leukocytes and fibroblasts. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLS |
| Sequence Similarities : | Belongs to the 3-oxoacid CoA-transferase family. |
| Gene Name | OXCT1 3-oxoacid CoA transferase 1 [ Homo sapiens ] |
| Official Symbol | OXCT1 |
| Synonyms | OXCT1; 3-oxoacid CoA transferase 1; 3 oxoacid CoA transferase , OXCT; succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial; SCOT; |
| Gene ID | 5019 |
| mRNA Refseq | NM_000436 |
| Protein Refseq | NP_000427 |
| MIM | 601424 |
| Uniprot ID | P55809 |
| Chromosome Location | 5p13 |
| Pathway | Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Ketone body metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; |
| Function | 3-oxoacid CoA-transferase activity; 3-oxoacid CoA-transferase activity; protein homodimerization activity; transferase activity; |
| ◆ Recombinant Proteins | ||
| OXCT1-12255M | Recombinant Mouse OXCT1 Protein | +Inquiry |
| OXCT1-30531TH | Recombinant Human OXCT1 | +Inquiry |
| OXCT1-3312H | Recombinant Human OXCT1 protein, His-tagged | +Inquiry |
| OXCT1-3083R | Recombinant Rhesus Macaque OXCT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| OXCT1-1715C | Recombinant Chicken OXCT1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OXCT1-3508HCL | Recombinant Human OXCT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OXCT1 Products
Required fields are marked with *
My Review for All OXCT1 Products
Required fields are marked with *
