Recombinant Human OXCT1
Cat.No. : | OXCT1-30531TH |
Product Overview : | Recombinant fragment of Human OXCT1 with a N terminal proprietary tag: predicted molecular weight 31.57 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency. |
Molecular Weight : | 31.570kDa inclusive of tags |
Tissue specificity : | Abundant in heart, followed in order by kidney, brain, and muscle, whereas in liver it is undetectable; also detectable in leukocytes and fibroblasts. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLS |
Sequence Similarities : | Belongs to the 3-oxoacid CoA-transferase family. |
Gene Name | OXCT1 3-oxoacid CoA transferase 1 [ Homo sapiens ] |
Official Symbol | OXCT1 |
Synonyms | OXCT1; 3-oxoacid CoA transferase 1; 3 oxoacid CoA transferase , OXCT; succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial; SCOT; |
Gene ID | 5019 |
mRNA Refseq | NM_000436 |
Protein Refseq | NP_000427 |
MIM | 601424 |
Uniprot ID | P55809 |
Chromosome Location | 5p13 |
Pathway | Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Ketone body metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; |
Function | 3-oxoacid CoA-transferase activity; 3-oxoacid CoA-transferase activity; protein homodimerization activity; transferase activity; |
◆ Recombinant Proteins | ||
OXCT1-769H | Recombinant Human OXCT1 Protein, His-tagged | +Inquiry |
OXCT1-6447M | Recombinant Mouse OXCT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OXCT1-3083R | Recombinant Rhesus Macaque OXCT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OXCT1-4777H | Recombinant Human OXCT1 Protein (Thr40-Leu489), His tagged | +Inquiry |
OXCT1-1903H | Recombinant Human OXCT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
OXCT1-3508HCL | Recombinant Human OXCT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OXCT1 Products
Required fields are marked with *
My Review for All OXCT1 Products
Required fields are marked with *