Recombinant Human OXT Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : OXT-5670H
Product Overview : OXT MS Standard C13 and N15-labeled recombinant protein (NP_000906) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a precursor protein that is processed to produce oxytocin and neurophysin I. Oxytocin is a posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Together with neurophysin, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis, where it is either stored or secreted into the bloodstream. The precursor seems to be activated while it is being transported along the axon to the posterior pituitary. This hormone contracts smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions.
Molecular Mass : 12.72 kDa
AA Sequence : MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name OXT oxytocin/neurophysin I prepropeptide [ Homo sapiens (human) ]
Official Symbol OXT
Synonyms OXT; oxytocin, prepropeptide; OT, oxytocin, prepro (neurophysin I); oxytocin-neurophysin 1; neurophysin I; oxytocin, prepro- (neurophysin I); oxytocin-neurophysin I, preproprotein; OT; OT-NPI; MGC126890; MGC126892;
Gene ID 5020
mRNA Refseq NM_000915
Protein Refseq NP_000906
MIM 167050
UniProt ID P01178

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OXT Products

Required fields are marked with *

My Review for All OXT Products

Required fields are marked with *

0
cart-icon