Recombinant Human PACRG Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PACRG-6267H
Product Overview : PACRG MS Standard C13 and N15-labeled recombinant protein (NP_001073847) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 29.3 kDa
AA Sequence : MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PACRG PARK2 co-regulated [ Homo sapiens (human) ]
Official Symbol PACRG
Synonyms PACRG; PARK2 co-regulated; parkin coregulated gene protein; FLJ32724; Glup; HAK005771; PARK2CRG; parkin co-regulated gene protein; molecular chaperone/chaperonin-binding protein; GLUP; RP3-495O10.2;
Gene ID 135138
mRNA Refseq NM_001080378
Protein Refseq NP_001073847
MIM 608427
UniProt ID Q96M98

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PACRG Products

Required fields are marked with *

My Review for All PACRG Products

Required fields are marked with *

0
cart-icon
0
compare icon