Recombinant Human PACRG Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PACRG-6267H |
Product Overview : | PACRG MS Standard C13 and N15-labeled recombinant protein (NP_001073847) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 29.3 kDa |
AA Sequence : | MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PACRG PARK2 co-regulated [ Homo sapiens (human) ] |
Official Symbol | PACRG |
Synonyms | PACRG; PARK2 co-regulated; parkin coregulated gene protein; FLJ32724; Glup; HAK005771; PARK2CRG; parkin co-regulated gene protein; molecular chaperone/chaperonin-binding protein; GLUP; RP3-495O10.2; |
Gene ID | 135138 |
mRNA Refseq | NM_001080378 |
Protein Refseq | NP_001073847 |
MIM | 608427 |
UniProt ID | Q96M98 |
◆ Recombinant Proteins | ||
PACRG-1782Z | Recombinant Zebrafish PACRG | +Inquiry |
PACRG-3097R | Recombinant Rhesus Macaque PACRG Protein, His (Fc)-Avi-tagged | +Inquiry |
Pacrg-4646M | Recombinant Mouse Pacrg Protein, Myc/DDK-tagged | +Inquiry |
PACRG-3279R | Recombinant Rhesus monkey PACRG Protein, His-tagged | +Inquiry |
PACRG-6267H | Recombinant Human PACRG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PACRG-3474HCL | Recombinant Human PACRG 293 Cell Lysate | +Inquiry |
PACRG-3475HCL | Recombinant Human PACRG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PACRG Products
Required fields are marked with *
My Review for All PACRG Products
Required fields are marked with *
0
Inquiry Basket