Recombinant Human PACRGL Protein, GST-Tagged
Cat.No. : | PACRGL-1323H |
Product Overview : | Human PACRGL full-length ORF (NP_659485.1, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | PACRGL (Parkin Coregulated Like) is a Protein Coding gene. GO annotations related to this gene include binding. An important paralog of this gene is PACRG. |
Molecular Mass : | 50.5 kDa |
AA Sequence : | MQKSEGSGGTQLKNRATGNYDQRTSSSTQLKHRNAVQGSKSSLSTSSPESARKLHPRPSDKLNPKTINPFGEQSRVPSAFAAIYSKGGIPCRLVHGSVKHRLQWECPPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLLPRLIPVLKAALVHSDDEVFERGLNALVQLSVVVGPSLNDHLKHLLTSGSLSIIKSKIPTYCSICC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PACRGL PARK2 co-regulated-like [ Homo sapiens ] |
Official Symbol | PACRGL |
Synonyms | PACRGL; PARK2 co-regulated-like; C4orf28, chromosome 4 open reading frame 28; PACRG-like protein; MGC29898; C4orf28; |
Gene ID | 133015 |
mRNA Refseq | NM_001130727 |
Protein Refseq | NP_001124199 |
UniProt ID | Q8N7B6 |
◆ Recombinant Proteins | ||
PACRGL-6465M | Recombinant Mouse PACRGL Protein, His (Fc)-Avi-tagged | +Inquiry |
PACRGL-3429HF | Recombinant Full Length Human PACRGL Protein, GST-tagged | +Inquiry |
PACRGL-207H | Recombinant Human PACRGL Protein, His-tagged | +Inquiry |
PACRGL-12296M | Recombinant Mouse PACRGL Protein | +Inquiry |
PACRGL-1323H | Recombinant Human PACRGL Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PACRGL Products
Required fields are marked with *
My Review for All PACRGL Products
Required fields are marked with *