Recombinant Human PACRGL Protein, GST-Tagged

Cat.No. : PACRGL-1323H
Product Overview : Human PACRGL full-length ORF (NP_659485.1, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : PACRGL (Parkin Coregulated Like) is a Protein Coding gene. GO annotations related to this gene include binding. An important paralog of this gene is PACRG.
Molecular Mass : 50.5 kDa
AA Sequence : MQKSEGSGGTQLKNRATGNYDQRTSSSTQLKHRNAVQGSKSSLSTSSPESARKLHPRPSDKLNPKTINPFGEQSRVPSAFAAIYSKGGIPCRLVHGSVKHRLQWECPPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLLPRLIPVLKAALVHSDDEVFERGLNALVQLSVVVGPSLNDHLKHLLTSGSLSIIKSKIPTYCSICC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PACRGL PARK2 co-regulated-like [ Homo sapiens ]
Official Symbol PACRGL
Synonyms PACRGL; PARK2 co-regulated-like; C4orf28, chromosome 4 open reading frame 28; PACRG-like protein; MGC29898; C4orf28;
Gene ID 133015
mRNA Refseq NM_001130727
Protein Refseq NP_001124199
UniProt ID Q8N7B6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PACRGL Products

Required fields are marked with *

My Review for All PACRGL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon