Recombinant Human PACSIN2, His-tagged

Cat.No. : PACSIN2-167H
Product Overview : Recombinant Human Protein Kinase C and Casein Kinase Substrate in Neurons Protein 2/PACSIN2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Gln486) of Human PACSIN2 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-486 a.a.
Description : Protein Kinase C and Casein Kinase Substrate in Neurons Protein 2 (PACSIN2) is a member of the PACSIN family. PACSIN2 is localized to the plasma membrane via its coiled-coil domain. PACSIN2 is widely expressed and contains one FCH domain and one SH3 domain. PACSIN2 forms homo- and hetero-aggregates with other PACSINs. PACSIN2 may play a role in vesicle formation and transport. In addition, PACSIN2 is involved in linking the actin cytoskeleton with vesicle formation by regulating tubulin polymerization.
AA Sequence : MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLTEWARR WRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNWQKEAFHKQMMGGFKE TKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKADPSLNPEQLKKLQDKIE KCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNV AGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVT LTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEK TQSYPTDWSDDESNNPFSSTDANGDSNPFDDDATSGTEVRVRALYDYEGQEHDELSFKAGDELTK MEDEDEQGWCKGRLDNGQVGLYPANYVEAIQVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name PACSIN2 protein kinase C and casein kinase substrate in neurons 2 [ Homo sapiens ]
Official Symbol PACSIN2
Synonyms PACSIN2; protein kinase C and casein kinase substrate in neurons 2; protein kinase C and casein kinase substrate in neurons protein 2; SDPII; syndapin II; cytoplasmic phosphoprotein PACSIN2;
Gene ID 11252
mRNA Refseq NM_001184970
Protein Refseq NP_001171899
MIM 604960
UniProt ID Q9UNF0
Chromosome Location 22q13.2-q13.33
Function cytoskeletal protein binding; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PACSIN2 Products

Required fields are marked with *

My Review for All PACSIN2 Products

Required fields are marked with *

0
cart-icon
0
compare icon