Recombinant Human PACSIN2, His-tagged
| Cat.No. : | PACSIN2-167H |
| Product Overview : | Recombinant Human Protein Kinase C and Casein Kinase Substrate in Neurons Protein 2/PACSIN2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Gln486) of Human PACSIN2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 1-486 a.a. |
| Description : | Protein Kinase C and Casein Kinase Substrate in Neurons Protein 2 (PACSIN2) is a member of the PACSIN family. PACSIN2 is localized to the plasma membrane via its coiled-coil domain. PACSIN2 is widely expressed and contains one FCH domain and one SH3 domain. PACSIN2 forms homo- and hetero-aggregates with other PACSINs. PACSIN2 may play a role in vesicle formation and transport. In addition, PACSIN2 is involved in linking the actin cytoskeleton with vesicle formation by regulating tubulin polymerization. |
| AA Sequence : | MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLTEWARR WRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNWQKEAFHKQMMGGFKE TKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKADPSLNPEQLKKLQDKIE KCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNV AGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVT LTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEK TQSYPTDWSDDESNNPFSSTDANGDSNPFDDDATSGTEVRVRALYDYEGQEHDELSFKAGDELTK MEDEDEQGWCKGRLDNGQVGLYPANYVEAIQVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | PACSIN2 protein kinase C and casein kinase substrate in neurons 2 [ Homo sapiens ] |
| Official Symbol | PACSIN2 |
| Synonyms | PACSIN2; protein kinase C and casein kinase substrate in neurons 2; protein kinase C and casein kinase substrate in neurons protein 2; SDPII; syndapin II; cytoplasmic phosphoprotein PACSIN2; |
| Gene ID | 11252 |
| mRNA Refseq | NM_001184970 |
| Protein Refseq | NP_001171899 |
| MIM | 604960 |
| UniProt ID | Q9UNF0 |
| Chromosome Location | 22q13.2-q13.33 |
| Function | cytoskeletal protein binding; transporter activity; |
| ◆ Recombinant Proteins | ||
| PACSIN2-3946C | Recombinant Chicken PACSIN2 | +Inquiry |
| PACSIN2-942H | Recombinant Human PACSIN2 protein, GST-tagged | +Inquiry |
| PACSIN2-6646C | Recombinant Chicken PACSIN2 | +Inquiry |
| PACSIN2-3971H | Recombinant Human PACSIN2 Protein (Met1-Gln486), C-His tagged | +Inquiry |
| PACSIN2-4942H | Recombinant Human PACSIN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PACSIN2-3473HCL | Recombinant Human PACSIN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PACSIN2 Products
Required fields are marked with *
My Review for All PACSIN2 Products
Required fields are marked with *




