Recombinant Human PACSIN2, His-tagged
Cat.No. : | PACSIN2-167H |
Product Overview : | Recombinant Human Protein Kinase C and Casein Kinase Substrate in Neurons Protein 2/PACSIN2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Gln486) of Human PACSIN2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-486 a.a. |
Description : | Protein Kinase C and Casein Kinase Substrate in Neurons Protein 2 (PACSIN2) is a member of the PACSIN family. PACSIN2 is localized to the plasma membrane via its coiled-coil domain. PACSIN2 is widely expressed and contains one FCH domain and one SH3 domain. PACSIN2 forms homo- and hetero-aggregates with other PACSINs. PACSIN2 may play a role in vesicle formation and transport. In addition, PACSIN2 is involved in linking the actin cytoskeleton with vesicle formation by regulating tubulin polymerization. |
AA Sequence : | MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLTEWARR WRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNWQKEAFHKQMMGGFKE TKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKADPSLNPEQLKKLQDKIE KCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNV AGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVT LTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEK TQSYPTDWSDDESNNPFSSTDANGDSNPFDDDATSGTEVRVRALYDYEGQEHDELSFKAGDELTK MEDEDEQGWCKGRLDNGQVGLYPANYVEAIQVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | PACSIN2 protein kinase C and casein kinase substrate in neurons 2 [ Homo sapiens ] |
Official Symbol | PACSIN2 |
Synonyms | PACSIN2; protein kinase C and casein kinase substrate in neurons 2; protein kinase C and casein kinase substrate in neurons protein 2; SDPII; syndapin II; cytoplasmic phosphoprotein PACSIN2; |
Gene ID | 11252 |
mRNA Refseq | NM_001184970 |
Protein Refseq | NP_001171899 |
MIM | 604960 |
UniProt ID | Q9UNF0 |
Chromosome Location | 22q13.2-q13.33 |
Function | cytoskeletal protein binding; transporter activity; |
◆ Recombinant Proteins | ||
PACSIN2-3946C | Recombinant Chicken PACSIN2 | +Inquiry |
PACSIN2-11801Z | Recombinant Zebrafish PACSIN2 | +Inquiry |
PACSIN2-1597H | Recombinant Human PACSIN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pacsin2-4649M | Recombinant Mouse Pacsin2 Protein, Myc/DDK-tagged | +Inquiry |
PACSIN2-1034HFL | Recombinant Full Length Human PACSIN2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PACSIN2-3473HCL | Recombinant Human PACSIN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PACSIN2 Products
Required fields are marked with *
My Review for All PACSIN2 Products
Required fields are marked with *
0
Inquiry Basket