Recombinant Human PACSIN2 protein, GST-tagged
Cat.No. : | PACSIN2-942H |
Product Overview : | Recombinant Human PACSIN2 protein(NP_001171899)(180-486 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 180-486 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | PSLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFDDDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAIQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
Gene Name | PACSIN2 protein kinase C and casein kinase substrate in neurons 2 [ Homo sapiens ] |
Official Symbol | PACSIN2 |
Synonyms | PACSIN2; protein kinase C and casein kinase substrate in neurons 2; protein kinase C and casein kinase substrate in neurons protein 2; SDPII; syndapin II; cytoplasmic phosphoprotein PACSIN2; |
Gene ID | 11252 |
mRNA Refseq | NM_001184970 |
Protein Refseq | NP_001171899 |
MIM | 604960 |
UniProt ID | Q9UNF0 |
◆ Recombinant Proteins | ||
PACSIN2-1034HFL | Recombinant Full Length Human PACSIN2 Protein, C-Flag-tagged | +Inquiry |
PACSIN2-942H | Recombinant Human PACSIN2 protein, GST-tagged | +Inquiry |
PACSIN2-3971H | Recombinant Human PACSIN2 Protein (Met1-Gln486), C-His tagged | +Inquiry |
Pacsin2-4649M | Recombinant Mouse Pacsin2 Protein, Myc/DDK-tagged | +Inquiry |
PACSIN2-167H | Recombinant Human PACSIN2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PACSIN2-3473HCL | Recombinant Human PACSIN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PACSIN2 Products
Required fields are marked with *
My Review for All PACSIN2 Products
Required fields are marked with *