Recombinant Human PAFAH1B3
Cat.No. : | PAFAH1B3-28937TH |
Product Overview : | Recombinant full length Human PAFAH1B3 with N-terminal proprietary tag. Predicted MW 51.52kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 231 amino acids |
Description : | This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with mental retardation, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. |
Molecular Weight : | 51.520kDa inclusive of tags |
Tissue specificity : | In the adult, expressed in brain, skeletal muscle, kidney, thymus, spleen, colon, testis, ovary and peripheral blood leukocytes. In the fetus, highest expression occurs in brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPE VVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHV LWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAI VQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVR AALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLG YTPVCRALHSLLLRLLAQDQGQGAPLLEPAP |
Sequence Similarities : | Belongs to the GDSL lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily. |
Gene Name | PAFAH1B3 platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa) [ Homo sapiens ] |
Official Symbol | PAFAH1B3 |
Synonyms | PAFAH1B3; platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa); platelet activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD) , platelet activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa , platelet a |
Gene ID | 5050 |
mRNA Refseq | NM_001145939 |
Protein Refseq | NP_001139411 |
MIM | 603074 |
Uniprot ID | Q15102 |
Chromosome Location | 19q13.1 |
Pathway | Ether lipid metabolism, organism-specific biosystem; Ether lipid metabolism, conserved biosystem; Lissencephaly gene (LIS1) in neuronal migration and development, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; |
Function | 1-alkyl-2-acetylglycerophosphocholine esterase activity; hydrolase activity; protein binding; |
◆ Recombinant Proteins | ||
Pafah1b3-4657M | Recombinant Mouse Pafah1b3 Protein, Myc/DDK-tagged | +Inquiry |
PAFAH1B3-11285Z | Recombinant Zebrafish PAFAH1B3 | +Inquiry |
PAFAH1B3-5067H | Recombinant Human PAFAH1B3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PAFAH1B3-6901H | Recombinant Human PAFAH1B3 protein, His & T7-tagged | +Inquiry |
PAFAH1B3-1613H | Recombinant Human PAFAH1B3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAFAH1B3-3467HCL | Recombinant Human PAFAH1B3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAFAH1B3 Products
Required fields are marked with *
My Review for All PAFAH1B3 Products
Required fields are marked with *
0
Inquiry Basket