Recombinant Human PAFAH1B3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PAFAH1B3-1613H
Product Overview : PAFAH1B3 MS Standard C13 and N15-labeled recombinant protein (NP_002564) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with cognitive disability, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described.
Molecular Mass : 25.7 kDa
AA Sequence : MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PAFAH1B3 platelet activating factor acetylhydrolase 1b catalytic subunit 3 [ Homo sapiens (human) ]
Official Symbol PAFAH1B3
Synonyms PAFAH1B3; platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa); platelet activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD), platelet activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa, platelet activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa); platelet-activating factor acetylhydrolase IB subunit gamma; PAF AH1b alpha 1 subunit; PAFAH subunit gamma; PAF-AH subunit gamma; PAF-AH 29 kDa subunit; PAF-AH1b alpha 1 subunit; PAF acetylhydrolase 29 kDa subunit; platelet-activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa); PAFAHG; FLJ44990;
Gene ID 5050
mRNA Refseq NM_002573
Protein Refseq NP_002564
MIM 603074
UniProt ID Q15102

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAFAH1B3 Products

Required fields are marked with *

My Review for All PAFAH1B3 Products

Required fields are marked with *

0
cart-icon
0
compare icon