Recombinant Human PAK1 protein, His-SUMO-tagged
Cat.No. : | PAK1-4366H |
Product Overview : | Recombinant Human PAK1 protein(Q13153)(1-545aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-545aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 76.6 kDa |
AA Sequence : | MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PAK1 p21 protein (Cdc42/Rac)-activated kinase 1 [ Homo sapiens ] |
Official Symbol | PAK1 |
Synonyms | PAK1; p21 protein (Cdc42/Rac)-activated kinase 1; p21/Cdc42/Rac1 activated kinase 1 (STE20 homolog, yeast) , p21/Cdc42/Rac1 activated kinase 1 (yeast Ste20 related); serine/threonine-protein kinase PAK 1; STE20 homolog; yeast; p65-PAK; alpha-PAK; STE20 homolog, yeast; p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related); p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast); PAKalpha; MGC130000; MGC130001; |
Gene ID | 5058 |
mRNA Refseq | NM_001128620 |
Protein Refseq | NP_001122092 |
MIM | 602590 |
UniProt ID | Q13153 |
◆ Recombinant Proteins | ||
PAK1-17H | Active Recombinant Human PAK1 | +Inquiry |
PAK1-4259R | Recombinant Rat PAK1 Protein | +Inquiry |
PAK1-11475Z | Recombinant Zebrafish PAK1 | +Inquiry |
PAK1-9380HF | Active Recombinant Full Length Human PAK1 Protein, GST-tagged | +Inquiry |
PAK1-821H | Recombinant Human PAK1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAK1-1275HCL | Recombinant Human PAK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAK1 Products
Required fields are marked with *
My Review for All PAK1 Products
Required fields are marked with *