Recombinant Human PALLD protein, His-tagged
Cat.No. : | PALLD-711H |
Product Overview : | Recombinant Human PALLD protein(Q8WX93)(Phe881-Tyr990), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Phe881-Tyr990 |
Form : | 0.15 M Phosphate buffered saline, pH 7.4 |
Molecular Mass : | 15 kDa |
Storage : | -20°C or lower, for long term storage. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | FPKKASRTARIASDEEIQGTKDAVIQDLERKLRFKEDLLNNGQPRLTYEERMARRLLGADSATVFNIQEPEEETANQEYKVSSCEQRLISEIEYRLERSPVDESGDEVQY |
Gene Name | PALLD palladin, cytoskeletal associated protein [ Homo sapiens ] |
Official Symbol | PALLD |
Synonyms | PALLD; palladin, cytoskeletal associated protein; palladin; CGI 151; KIAA0992; SIH002; myoneurin; sarcoma antigen NY-SAR-77; MYN; PNCA1; CGI151; CGI-151; FLJ22190; FLJ38193; FLJ39139; FLJ61376; |
Gene ID | 23022 |
mRNA Refseq | NM_001166108 |
Protein Refseq | NP_001159580 |
MIM | 608092 |
UniProt ID | Q8WX93 |
◆ Recombinant Proteins | ||
PALLD-711H | Recombinant Human PALLD protein, His-tagged | +Inquiry |
PALLD-6479M | Recombinant Mouse PALLD Protein, His (Fc)-Avi-tagged | +Inquiry |
PALLD-12326M | Recombinant Mouse PALLD Protein | +Inquiry |
PALLD-7150H | Recombinant Human PALLD protein, His & T7-tagged | +Inquiry |
PALLD-1517H | Recombinant Human PALLD, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PALLD-469HCL | Recombinant Human PALLD lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PALLD Products
Required fields are marked with *
My Review for All PALLD Products
Required fields are marked with *