Recombinant Human PALLD protein, His-tagged

Cat.No. : PALLD-711H
Product Overview : Recombinant Human PALLD protein(Q8WX93)(Phe881-Tyr990), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Phe881-Tyr990
Form : 0.15 M Phosphate buffered saline, pH 7.4
Molecular Mass : 15 kDa
Storage : -20°C or lower, for long term storage.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : FPKKASRTARIASDEEIQGTKDAVIQDLERKLRFKEDLLNNGQPRLTYEERMARRLLGADSATVFNIQEPEEETANQEYKVSSCEQRLISEIEYRLERSPVDESGDEVQY
Gene Name PALLD palladin, cytoskeletal associated protein [ Homo sapiens ]
Official Symbol PALLD
Synonyms PALLD; palladin, cytoskeletal associated protein; palladin; CGI 151; KIAA0992; SIH002; myoneurin; sarcoma antigen NY-SAR-77; MYN; PNCA1; CGI151; CGI-151; FLJ22190; FLJ38193; FLJ39139; FLJ61376;
Gene ID 23022
mRNA Refseq NM_001166108
Protein Refseq NP_001159580
MIM 608092
UniProt ID Q8WX93

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PALLD Products

Required fields are marked with *

My Review for All PALLD Products

Required fields are marked with *

0
cart-icon