Recombinant Human PAM16 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PAM16-1733H
Product Overview : TIMM16 MS Standard C13 and N15-labeled recombinant protein (NP_057153) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a mitochondrial protein involved in granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling. This protein also plays a role in the import of nuclear-encoded mitochondrial proteins into the mitochondrial matrix and may be important in reactive oxygen species (ROS) homeostasis. Mutations in this gene cause Megarbane-Dagher-Melike type spondylometaphyseal dysplasia, an early lethal skeletal dysplasia characterized by short stature, developmental delay and other skeletal abnormalities.
Molecular Mass : 13.8 kDa
AA Sequence : MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PAM16 presequence translocase associated motor 16 [ Homo sapiens (human) ]
Official Symbol PAM16
Synonyms PAM16; presequence translocase associated motor 16; TIM16; MAGMAS; SMDMDM; TIMM16; CGI-136; mitochondrial import inner membrane translocase subunit TIM16; magmas-like protein; mitochondria associated protein involved in granulocyte macrophage colony stimulating factor signal transduction; mitochondria-associated granulocyte macrophage CSF-signaling molecule; presequence translocase associated motor 16 homolog
Gene ID 51025
mRNA Refseq NM_016069
Protein Refseq NP_057153
MIM 614336
UniProt ID Q9Y3D7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAM16 Products

Required fields are marked with *

My Review for All PAM16 Products

Required fields are marked with *

0
cart-icon
0
compare icon