Recombinant Human PAM16 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PAM16-1733H
• Product Overview: TIMM16 MS Standard C13 and N15-labeled recombinant protein (NP_057153) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a mitochondrial protein involved in granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling. This protein also plays a role in the import of nuclear-encoded mitochondrial proteins into the mitochondrial matrix and may be important in reactive oxygen species (ROS) homeostasis. Mutations in this gene cause Megarbane-Dagher-Melike type spondylometaphyseal dysplasia, an early lethal skeletal dysplasia characterized by short stature, developmental delay and other skeletal abnormalities.
• Molecular Mass: 13.8 kDa
• AA Sequence: MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PAM16 presequence translocase associated motor 16 [ Homo sapiens (human) ]
• Official Symbol: PAM16
• Synonyms: PAM16; presequence translocase associated motor 16; TIM16; MAGMAS; SMDMDM; TIMM16; CGI-136; mitochondrial import inner membrane translocase subunit TIM16; magmas-like protein; mitochondria associated protein involved in granulocyte macrophage colony stimulating factor signal transduction; mitochondria-associated granulocyte macrophage CSF-signaling molecule; presequence translocase associated motor 16 homolog
• Gene ID: 51025
• mRNA Refseq: NM_016069
• Protein Refseq: NP_057153
• MIM: 614336
• UniProt ID: Q9Y3D7