Recombinant Human PAM16 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PAM16-1733H |
Product Overview : | TIMM16 MS Standard C13 and N15-labeled recombinant protein (NP_057153) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a mitochondrial protein involved in granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling. This protein also plays a role in the import of nuclear-encoded mitochondrial proteins into the mitochondrial matrix and may be important in reactive oxygen species (ROS) homeostasis. Mutations in this gene cause Megarbane-Dagher-Melike type spondylometaphyseal dysplasia, an early lethal skeletal dysplasia characterized by short stature, developmental delay and other skeletal abnormalities. |
Molecular Mass : | 13.8 kDa |
AA Sequence : | MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PAM16 presequence translocase associated motor 16 [ Homo sapiens (human) ] |
Official Symbol | PAM16 |
Synonyms | PAM16; presequence translocase associated motor 16; TIM16; MAGMAS; SMDMDM; TIMM16; CGI-136; mitochondrial import inner membrane translocase subunit TIM16; magmas-like protein; mitochondria associated protein involved in granulocyte macrophage colony stimulating factor signal transduction; mitochondria-associated granulocyte macrophage CSF-signaling molecule; presequence translocase associated motor 16 homolog |
Gene ID | 51025 |
mRNA Refseq | NM_016069 |
Protein Refseq | NP_057153 |
MIM | 614336 |
UniProt ID | Q9Y3D7 |
◆ Recombinant Proteins | ||
PAM16-12329M | Recombinant Mouse PAM16 Protein | +Inquiry |
PAM16-6480M | Recombinant Mouse PAM16 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAM16-301485H | Recombinant Human PAM16 protein, GST-tagged | +Inquiry |
PAM16-11060Z | Recombinant Zebrafish PAM16 | +Inquiry |
PAM16-1167H | Recombinant Human PAM16 Protein (1-125 aa), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAM16-1071HCL | Recombinant Human TIMM16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAM16 Products
Required fields are marked with *
My Review for All PAM16 Products
Required fields are marked with *