Recombinant Human PAM16 Protein (1-125 aa), GST-tagged

Cat.No. : PAM16-1167H
Product Overview : Recombinant Human PAM16 Protein (1-125 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-125 aa
Description : Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 40.8 kDa
AA Sequence : MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name PAM16 presequence translocase associated motor 16 [ Homo sapiens (human) ]
Official Symbol PAM16
Synonyms TIM16; MAGMAS; SMDMDM; TIMM16; CGI-136;
Gene ID 51025
mRNA Refseq NM_016069
Protein Refseq NP_057153
UniProt ID Q9Y3D7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAM16 Products

Required fields are marked with *

My Review for All PAM16 Products

Required fields are marked with *

0
cart-icon
0
compare icon