Recombinant Human PAM16 Protein (1-125 aa), GST-tagged
Cat.No. : | PAM16-1167H |
Product Overview : | Recombinant Human PAM16 Protein (1-125 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-125 aa |
Description : | Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 40.8 kDa |
AA Sequence : | MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | PAM16 presequence translocase associated motor 16 [ Homo sapiens (human) ] |
Official Symbol | PAM16 |
Synonyms | TIM16; MAGMAS; SMDMDM; TIMM16; CGI-136; |
Gene ID | 51025 |
mRNA Refseq | NM_016069 |
Protein Refseq | NP_057153 |
UniProt ID | Q9Y3D7 |
◆ Recombinant Proteins | ||
PAM16-12329M | Recombinant Mouse PAM16 Protein | +Inquiry |
PAM16-11060Z | Recombinant Zebrafish PAM16 | +Inquiry |
PAM16-301485H | Recombinant Human PAM16 protein, GST-tagged | +Inquiry |
PAM16-1167H | Recombinant Human PAM16 Protein (1-125 aa), GST-tagged | +Inquiry |
PAM16-1196C | Recombinant Chicken PAM16 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAM16-1071HCL | Recombinant Human TIMM16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAM16 Products
Required fields are marked with *
My Review for All PAM16 Products
Required fields are marked with *