Recombinant Human PAM16 Protein (1-125 aa), GST-tagged

• Cat.No.: PAM16-1167H
• Product Overview: Recombinant Human PAM16 Protein (1-125 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-125 aa
• Description: Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 40.8 kDa
• AA Sequence: MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: PAM16 presequence translocase associated motor 16 [ Homo sapiens (human) ]
• Official Symbol: PAM16
• Synonyms: TIM16; MAGMAS; SMDMDM; TIMM16; CGI-136
• Gene ID: 51025
• mRNA Refseq: NM_016069
• Protein Refseq: NP_057153
• UniProt ID: Q9Y3D7