Recombinant Human PANX1 protein, GST-tagged
Cat.No. : | PANX1-301600H |
Product Overview : | Recombinant Human PANX1 (126-426 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Phe126-Cys426 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
AA Sequence : | FWRFAAAPHICSDLKFIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLGQSLWEVSESHFKYPIVEQYLKTKKNSNNLIIKYISCRLLTLIIILLACIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINLVVYVLLAPVVVYTLFVPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PANX1 pannexin 1 [ Homo sapiens ] |
Official Symbol | PANX1 |
Synonyms | PANX1; pannexin 1; pannexin-1; innexin; MRS1; PX1; UNQ2529; MGC21309; |
Gene ID | 24145 |
mRNA Refseq | NM_015368 |
Protein Refseq | NP_056183 |
MIM | 608420 |
UniProt ID | Q96RD7 |
◆ Recombinant Proteins | ||
PANX1-1348H | Recombinant Human PANX1 protein, His & T7-tagged | +Inquiry |
PANX1-12337M | Recombinant Mouse PANX1 Protein | +Inquiry |
PANX1-301600H | Recombinant Human PANX1 protein, GST-tagged | +Inquiry |
RFL4250RF | Recombinant Full Length Rat Pannexin-1(Panx1) Protein, His-Tagged | +Inquiry |
Panx1-1349R | Recombinant Rat Panx1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PANX1-3443HCL | Recombinant Human PANX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PANX1 Products
Required fields are marked with *
My Review for All PANX1 Products
Required fields are marked with *