Recombinant Human PANX2 protein, GST-tagged
Cat.No. : | PANX2-301209H |
Product Overview : | Recombinant Human PANX2 (70-170 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Glu70-Asp170 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | ESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPSANPAEPDGAAEPPVVKRPRKKMKWIPTSNPLPQPFKEPLAIMRVENSKAEKPKPARRKTATD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PANX2 pannexin 2 [ Homo sapiens ] |
Official Symbol | PANX2 |
Synonyms | PX2; hPANX2 |
Gene ID | 56666 |
mRNA Refseq | NM_052839.3 |
Protein Refseq | NP_443071.2 |
MIM | 608421 |
UniProt ID | Q96RD6 |
◆ Recombinant Proteins | ||
PANX2-301209H | Recombinant Human PANX2 protein, GST-tagged | +Inquiry |
Panx2-1897M | Recombinant Mouse Panx2 Protein, His-tagged | +Inquiry |
PANX2-4267R | Recombinant Rat PANX2 Protein | +Inquiry |
RFL31544HF | Recombinant Full Length Human Pannexin-2(Panx2) Protein, His-Tagged | +Inquiry |
PANX2-8179Z | Recombinant Zebrafish PANX2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PANX2 Products
Required fields are marked with *
My Review for All PANX2 Products
Required fields are marked with *