Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PAQR6 protein, GST-tagged

Cat.No. : PAQR6-301133H
Product Overview : Recombinant Human PAQR6 (175-218 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
Source : E. coli
Species : Human
Tag : GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Protein length : Leu175-Ala218
AA Sequence : LESPGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEA
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name : PAQR6 progestin and adipoQ receptor family member VI [ Homo sapiens ]
Official Symbol : PAQR6
Synonyms : PAQR6; progestin and adipoQ receptor family member VI; progestin and adipoQ receptor family member 6; FLJ22672;
Gene ID : 79957
mRNA Refseq : NM_024897
Protein Refseq : NP_079173
MIM : 614579
UniProt ID : Q6TCH4

Products Types

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends