Recombinant Human PARK2
Cat.No. : | PARK2-30785TH |
Product Overview : | Recombinant fragment corresponding to amino acids 288-387 of Human Parkin with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The precise function of this gene is unknown; however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects dopamine neurons fro |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK |
Sequence Similarities : | Belongs to the RBR family. Parkin subfamily.Contains 1 IBR-type zinc finger.Contains 2 RING-type zinc fingers.Contains 1 ubiquitin-like domain. |
Gene Name | PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) [ Homo sapiens ] |
Official Symbol | PARK2 |
Synonyms | PARK2; parkinson protein 2, E3 ubiquitin protein ligase (parkin); Parkinson disease (autosomal recessive, juvenile) 2, parkin; E3 ubiquitin-protein ligase parkin; AR JP; E3 ubiquitin ligase; parkin; PDJ; |
Gene ID | 5071 |
mRNA Refseq | NM_004562 |
Protein Refseq | NP_004553 |
MIM | 602544 |
Uniprot ID | O60260 |
Chromosome Location | 6q25.2-q27 |
Pathway | Adaptive Immune System, organism-specific biosystem; Alpha-synuclein signaling, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & |
Function | PDZ domain binding; acid-amino acid ligase activity; chaperone binding; kinase binding; ligase activity; |
◆ Recombinant Proteins | ||
Park2-4799R | Recombinant Rat Park2 protein, His&Myc-tagged | +Inquiry |
PARK2-332H | Active Recombinant Human PARK2 protein | +Inquiry |
PARK2-11H | Recombinant Human PARK2 protein, His-tagged | +Inquiry |
PARK2-12362M | Recombinant Mouse PARK2 Protein | +Inquiry |
PARK2-6497M | Recombinant Mouse PARK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PARK2-3433HCL | Recombinant Human PARK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PARK2 Products
Required fields are marked with *
My Review for All PARK2 Products
Required fields are marked with *