"PARK2" Related Products

Expand
Expand

Recombinant Human PARK2 protein

Cat.No.: PARK2-422H
Product Overview: Recombinant Human PARK2(1-465 aa) was expressed in E. coli.
Source: E. coli
Species: Human
Form: 50 mM Hepes pH 7.5, 150 mM NaCl, 2 mM DTT, 10% glycerol
Molecular Mass: ~51.6 kDa
AA Sequence: MIVFVRFNSSHGFPVEVDSDTSIFQLKEV VAKRQGVPADQLRVIFAGKELRNDWT VQNCDLDQQSIVHIVQRPWRKGQEMNAT GGDDPRNAAGGCEREPQSLTRVDLSSSV LPGDSVGLAVILHTDSRKDSPPAGSPAGR SIYNSFYVYCKGPCQRVQPGKLRVQCST CRQATLTLTQGPSCWDDVLIPNRMSGEC QSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRH VICLDCFHLYCVTRLNDRQFVHDPQLGYS LPCVAGCPNSLIKELHHFRILGEEQYNRY QQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGEC SAVFEASGTTTQAYRVDERAAEQARWEAAS KETIKKTTKPCPRCHVPVEKNGGCMHM KCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV
Purity: >90% by SDS-PAGE
Stability: 12 months at -70 centigrade; aliquot as required
Storage: Storage at -70 centigrade
Concentration: 0.5 mg/ml
Gene Name: PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) [ Homo sapiens ]
Official Symbol: PARK2
Synonyms: PARK2; parkinson protein 2, E3 ubiquitin protein ligase (parkin); Parkinson disease (autosomal recessive, juvenile) 2, parkin; E3 ubiquitin-protein ligase parkin; AR JP; E3 ubiquitin ligase; parkin; PDJ; parkin 2; parkinson disease protein 2; parkinson juvenile disease protein 2; PRKN; AR-JP; LPRS2;
Gene ID: 5071
mRNA Refseq: NM_004562
Protein Refseq: NP_004553
MIM: 602544
UniProt ID: O60260
Chromosome Location: 6q25.2-q27
Pathway: Adaptive Immune System, organism-specific biosystem; Alpha-synuclein signaling, organism-specific biosystem; Antigen processing: Ubiquitination and Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Immune System, organism-specific biosystem;
Function: PDZ domain binding; acid-amino acid ligase activity; chaperone binding; kinase binding; ligase activity; metal ion binding; protein binding; protein kinase binding; ubiquitin protein ligase binding; ubiquitin-protein ligase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.