Recombinant Human PARK2 protein PARK2-422H

Recombinant Human PARK2 protein

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human PARK2 protein

Recombinant Human PARK2 protein

PARK2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : PARK2-422H
Product Overview : Recombinant Human PARK2(1-465 aa) was expressed in E. coli.
Source : E. coli
Species : Human
Form : 50 mM Hepes pH 7.5, 150 mM NaCl, 2 mM DTT, 10% glycerol
Molecular Mass : ~51.6 kDa
AA Sequence : MIVFVRFNSSHGFPVEVDSDTSIFQLKEV VAKRQGVPADQLRVIFAGKELRNDWT VQNCDLDQQSIVHIVQRPWRKGQEMNAT GGDDPRNAAGGCEREPQSLTRVDLSSSV LPGDSVGLAVILHTDSRKDSPPAGSPAGR SIYNSFYVYCKGPCQRVQPGKLRVQCST CRQATLTLTQGPSCWDDVLIPNRMSGEC QSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRH VICLDCFHLYCVTRLNDRQFVHDPQLGYS LPCVAGCPNSLIKELHHFRILGEEQYNRY QQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGEC SAVFEASGTTTQAYRVDERAAEQARWEAAS KETIKKTTKPCPRCHVPVEKNGGCMHM KCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV
Purity : >90% by SDS-PAGE
Stability : 12 months at -70 centigrade; aliquot as required
Storage : Storage at -70 centigrade
Concentration : 0.5 mg/ml
Gene Name : PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) [ Homo sapiens ]
Official Symbol : PARK2
Synonyms : PARK2; parkinson protein 2, E3 ubiquitin protein ligase (parkin); Parkinson disease (autosomal recessive, juvenile) 2, parkin; E3 ubiquitin-protein ligase parkin; AR JP; E3 ubiquitin ligase; parkin; PDJ; parkin 2; parkinson disease protein 2; parkinson juvenile disease protein 2; PRKN; AR-JP; LPRS2;
Gene ID : 5071
mRNA Refseq : NM_004562
Protein Refseq : NP_004553
MIM : 602544
UniProt ID : O60260
Chromosome Location : 6q25.2-q27
Pathway : Adaptive Immune System, organism-specific biosystem; Alpha-synuclein signaling, organism-specific biosystem; Antigen processing: Ubiquitination and Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Immune System, organism-specific biosystem;
Function : PDZ domain binding; acid-amino acid ligase activity; chaperone binding; kinase binding; ligase activity; metal ion binding; protein binding; protein kinase binding; ubiquitin protein ligase binding; ubiquitin-protein ligase activity; zinc ion binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Back to School Promotion

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy