Recombinant Human PARK7
Cat.No. : | PARK7-30783TH |
Product Overview : | Recombinant Full Length Human PARK7/DJ1 expressed in Saccharomyces cerevisiae; amino acids 1-189; 189 amino acids, MWt 19.9 kDa. Protein is tagged with 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-189 a.a. |
Description : | The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene. |
Tissue specificity : | Highly expressed in pancreas, kidney, skeletal muscle, liver, testis and heart. Detected at slightly lower levels in placenta and brain. Detected in astrocytes, Sertoli cells, spermatogonia, spermatids and spermatozoa. |
Biological activity : | This protein contains a proprietary tag (26 kDa) and the whole proteins MW is around 45KD. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAG KDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLG AQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHE IGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSR GPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD |
Sequence Similarities : | Belongs to the peptidase C56 family. |
Full Length : | Full L. |
Gene Name | PARK7 parkinson protein 7 [ Homo sapiens ] |
Official Symbol | PARK7 |
Synonyms | PARK7; parkinson protein 7; Parkinson disease (autosomal recessive, early onset) 7; protein DJ-1; DJ 1; DJ1; |
Gene ID | 11315 |
mRNA Refseq | NM_001123377 |
Protein Refseq | NP_001116849 |
MIM | 602533 |
Uniprot ID | Q99497 |
Chromosome Location | 1p36.23 |
Pathway | Alpha-synuclein signaling, organism-specific biosystem; Parkinsons disease, organism-specific biosystem; |
Function | mRNA binding; peptidase activity; peroxidase activity; peroxiredoxin activity; protein binding; |
◆ Recombinant Proteins | ||
Park7-34M | Recombinant Mouse Park7 protein, His-tagged | +Inquiry |
Park7-1805R | Recombinant Rat Park7 protein, His-tagged | +Inquiry |
PARK7-6498M | Recombinant Mouse PARK7 Protein, His (Fc)-Avi-tagged | +Inquiry |
PARK7-4765H | Recombinant Human PARK7 protein, His-GST-tagged | +Inquiry |
PARK7-114H | Recombinant Human PARK7, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PARK7-3432HCL | Recombinant Human PARK7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PARK7 Products
Required fields are marked with *
My Review for All PARK7 Products
Required fields are marked with *
0
Inquiry Basket