Recombinant Human PARL Full Length Transmembrane protein, Myc-tagged
Cat.No. : | PARL-394H |
Product Overview : | Recombinant Human PARL protein(Q9H300)(53-379aa), fused with C-terminal Myc tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Myc |
Protein Length : | 53-379aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.8 kDa |
AA Sequence : | FRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVTGIIAANVLVFCLWRVPSLQRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGASGAIMTVLAAVCTKIPEGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGHELIWKNREPLVKIWHEIRTNGPKKGGGSK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | PARL presenilin associated, rhomboid-like [ Homo sapiens ] |
Official Symbol | PARL |
Synonyms | PARL; presenilin associated, rhomboid-like; PSARL; presenilins-associated rhomboid-like protein, mitochondrial; PRO2207; PSARL1; RHBDS1; rhomboid 7 homolog 1 (Drosophila); rhomboid 7 homolog 1; mitochondrial intramembrane cleaving protease PARL; mitochondrial intramembrane-cleaving protease PARL; PSENIP2; |
Gene ID | 55486 |
mRNA Refseq | NM_001037639 |
Protein Refseq | NP_001032728 |
MIM | 607858 |
UniProt ID | Q9H300 |
◆ Cell & Tissue Lysates | ||
PARL-3431HCL | Recombinant Human PARL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PARL Products
Required fields are marked with *
My Review for All PARL Products
Required fields are marked with *