Recombinant Human PARL Full Length Transmembrane protein, Myc-tagged

Cat.No. : PARL-394H
Product Overview : Recombinant Human PARL protein(Q9H300)(53-379aa), fused with C-terminal Myc tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Myc
Protein Length : 53-379aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 37.8 kDa
AA Sequence : FRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVTGIIAANVLVFCLWRVPSLQRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGASGAIMTVLAAVCTKIPEGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGHELIWKNREPLVKIWHEIRTNGPKKGGGSK
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name PARL presenilin associated, rhomboid-like [ Homo sapiens ]
Official Symbol PARL
Synonyms PARL; presenilin associated, rhomboid-like; PSARL; presenilins-associated rhomboid-like protein, mitochondrial; PRO2207; PSARL1; RHBDS1; rhomboid 7 homolog 1 (Drosophila); rhomboid 7 homolog 1; mitochondrial intramembrane cleaving protease PARL; mitochondrial intramembrane-cleaving protease PARL; PSENIP2;
Gene ID 55486
mRNA Refseq NM_001037639
Protein Refseq NP_001032728
MIM 607858
UniProt ID Q9H300

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PARL Products

Required fields are marked with *

My Review for All PARL Products

Required fields are marked with *

0
cart-icon
0
compare icon