Recombinant Human PARP14 protein, His&Myc-tagged
| Cat.No. : | PARP14-4456H |
| Product Overview : | Recombinant Human PARP14 protein(Q460N5)(1605-1801aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His&Myc |
| Protein Length : | 1605-1801aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.5 kDa |
| AA Sequence : | IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | PARP14 poly (ADP-ribose) polymerase family, member 14 [ Homo sapiens ] |
| Official Symbol | PARP14 |
| Synonyms | PARP14; poly (ADP-ribose) polymerase family, member 14; poly [ADP-ribose] polymerase 14; KIAA1268; pART8; collaborator of STAT6; B-aggressive lymphoma 2; b aggressive lymphoma protein 2; BAL2; PARP-14; |
| Gene ID | 54625 |
| mRNA Refseq | NM_017554 |
| Protein Refseq | NP_060024 |
| MIM | 610028 |
| UniProt ID | Q460N5 |
| ◆ Recombinant Proteins | ||
| PARP14-5906H | Recombinant Human PARP14 protein, His&Myc-tagged | +Inquiry |
| PARP14-5939H | Recombinant Human PARP14 protein, hFc-tagged | +Inquiry |
| PARP14-0079H | Recombinant Human PARP14 Protein (F1208-E1387), His/Strep tagged | +Inquiry |
| PARP14-6504M | Recombinant Mouse PARP14 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PARP14-4456H | Recombinant Human PARP14 protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PARP14 Products
Required fields are marked with *
My Review for All PARP14 Products
Required fields are marked with *
