Recombinant Human PARP16, GST-tagged
| Cat.No. : | PARP16-1129H |
| Product Overview : | Recombinant Human PARP16 full-length ORF(1 a.a - 323 a.a) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Poly (ADP-ribose) polymerase family, member 16 is a protein in humans that is encoded by the PARP16 gene. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 62.9 kDa |
| AA Sequence : | MQPSGWAAAREAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSS GDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVPAPDFLFEIEYFDPANAKFYETKGERDLIYA FHGSRLENFHSIIHNGLHCHLNKTSLFGEGTYLTSDLSLALIYSPHGHGWQHSLLGPILSCVAVCEVIDHPDVKC QTKKKDSKEIDRRRARIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYL LLLLIVSVINSSAFQHFWNRAKR |
| Applications : | AP, Array, ELISA, WB-Re |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | PARP16 poly (ADP-ribose) polymerase family, member 16 [ Homo sapiens ] |
| Official Symbol | PARP16 |
| Synonyms | ARTD15; pART15; C15orf30; mono [ADP-ribose] polymerase PARP16; ADP-ribosyltransferase diphtheria toxin-like 15; PARP-16; poly [ADP-ribose] polymerase 16; C15orf30, FLJ20509, FLJ25281 |
| Gene ID | 54956 |
| mRNA Refseq | NM_017851 |
| Protein Refseq | NP_060321 |
| UniProt ID | Q8N5Y8 |
| Chromosome Location | 15q22.31 |
| Function | NAD+ ADP-ribosyltransferase activity; kinase binding; protein binding |
| ◆ Recombinant Proteins | ||
| PARP16-6505M | Recombinant Mouse PARP16 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PARP16-12372M | Recombinant Mouse PARP16 Protein | +Inquiry |
| PARP16-5095HFL | Recombinant Full Length Human PARP16 protein, Flag-tagged | +Inquiry |
| PARP16-1532H | Recombinant Human PARP16, His-tagged | +Inquiry |
| PARP16-556HF | Recombinant Full Length Human PARP16 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PARP16-3428HCL | Recombinant Human PARP16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PARP16 Products
Required fields are marked with *
My Review for All PARP16 Products
Required fields are marked with *
